KEGG   Colwellia beringensis: B5D82_00405Help
Entry
B5D82_00405       CDS       T05628                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cber  Colwellia beringensis
Pathway
cber00473  D-Alanine metabolism
cber00550  Peptidoglycan biosynthesis
cber01100  Metabolic pathways
cber01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cber00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B5D82_00405
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B5D82_00405
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B5D82_00405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cber01011]
    B5D82_00405
Enzymes [BR:cber01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B5D82_00405
Peptidoglycan biosynthesis and degradation proteins [BR:cber01011]
 Precursor biosynthesis
  Amino acid ligase
   B5D82_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp GARS_A Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: ASP49816
UniProt: A0A222GD77
LinkDB All DBs
Position
92414..93337
Genome map
AA seq 307 aa AA seqDB search
MEEKLAVLYGGTSAERAVSLNSGKAVAKGLKEAGFNVQLIDTQDYCLSDLVKLDIDRVFI
ALHGRGGEDGCVQGALQYMNIPYTGSDVLGSALSMDKIRSKQVFQALNLPTAAFAIVDKA
HYQAEDAANILQELGNVVMVKPANEGSSIGMSKANNAEELHQALIAAFHYDHQILVEAWV
QGPEYTVAILGQTPLPVIHMVTPNDFYDYDAKYKANTTQYHCPCSLSAEDEAELQSIALK
AFNATGAKGWGRVDVMRNAQGQWQLLEVNTVPGMTETSLVPKAAKVHGLSFSELVTKIVA
LSAQGSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaattagctgttttatatggtggtacatcagcagaaagagcggtgtcactt
aattcaggaaaagcagtggctaaaggcttaaaagaagcgggtttcaatgttcagcttatt
gatactcaagattactgcttaagtgatttagtaaaattagatattgaccgtgtgtttata
gctttacatggccgtggtggagaagacggttgtgtgcagggtgcactgcaatatatgaat
attccttataccggatctgatgtactgggttcagcattatcgatggataaaattcgcagt
aagcaagtctttcaagcgttgaatctaccgactgctgcctttgctattgtcgataaagca
cattatcaagcagaagatgcggcaaatatattacaagagttaggcaatgtggtcatggtt
aagcctgcgaatgaaggttcaagcattggcatgtctaaggcaaataatgccgaagaattg
catcaggcacttatcgctgcttttcattacgaccatcaaattttggtagaggcttgggtt
caaggcccagaatacactgtcgctattttagggcaaacgccgttacccgttatccatatg
gtaaccccgaacgatttttatgactacgacgcaaaatataaagctaacacgacgcaatat
cattgtccgtgttcactctctgctgaggacgaagctgaactacaaagtatcgccttaaaa
gcatttaatgctactggcgctaaagggtgggggcgagtagatgttatgcgcaatgcgcaa
ggtcaatggcagttattggaagtcaatacagtaccgggcatgacagaaacgtcattggtc
cctaaagccgcgaaggtgcacggcttaagttttagcgaattggtgaccaaaattgttgcg
ttaagcgcacaaggtagtgcgtaa

DBGET integrated database retrieval system