KEGG   Colwellia beringensis: B5D82_02410Help
Entry
B5D82_02410       CDS       T05628                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
cber  Colwellia beringensis
Pathway
cber00521  Streptomycin biosynthesis
cber00562  Inositol phosphate metabolism
cber01100  Metabolic pathways
cber01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cber00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    B5D82_02410
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B5D82_02410
Enzymes [BR:cber01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     B5D82_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase_glpX FBPase
Motif
Other DBs
NCBI-ProteinID: ASP46731
UniProt: A0A222G4L1
LinkDB All DBs
Position
complement(582348..583151)
Genome map
AA seq 267 aa AA seqDB search
MHPMLNIAVRSARAAGKVILRAFEQVDKIEIESKGTNDIVTNVDISAELAIVETIQKSYP
HHTIIGEECGVIEGKESDYQWIIDPLDGTSNFVKGIPHFAVSIALKVKGKLDQSVIYDPI
RGELFTASRGKGAQLNGFRIRVKQSKELKGSILATGFPFKHKQHTNAYLEMFKTLFGKTS
DMRRAGSAALDLAYVAAGRVDGYFEIGLKPWDTAAGELMVIEAGGLVTDFVGGHNHSNSG
NIVASSPRLAKEILKDIRPHLGEALSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgatgctaaatattgccgtgcgctctgcacgtgctgcgggcaaagtaattctg
cgcgcttttgaacaagtagataagattgaaattgaatctaagggtactaacgatatcgtt
actaatgttgatataagtgctgaactagctattgttgaaacaattcaaaaatcttaccca
caccacaccattattggtgaagagtgtggcgttatagaaggtaaagaaagtgactatcag
tggattattgatccattagacggtacttctaacttcgttaaaggtattccacactttgcg
gtttcaatcgctttaaaagttaaaggaaaattagatcaatcagtgatctacgatcctatc
cgtggtgagttatttacggcaagtcgtggtaaaggtgctcaattaaacggtttccgtatt
cgcgtgaaacaatctaaagaacttaaaggttctattttggcgacaggcttccctttcaaa
cataagcaacacactaatgcttatttagaaatgtttaaaacacttttcggtaaaacatca
gatatgcgtcgcgctggctctgccgcgttagatttagcttatgttgctgctggacgcgtt
gacggttatttcgaaattggcttaaagccatgggatacagctgccggtgaattaatggtc
atcgaagcaggtggtttagtcactgactttgttggcggtcataatcacagcaactcgggt
aacattgttgcaagtagcccacgtttagccaaagaaatcttaaaagatattcgtcctcac
ttaggtgaagcattaagcaagtaa

DBGET integrated database retrieval system