KEGG   Colwellia beringensis: B5D82_10725Help
Entry
B5D82_10725       CDS       T05628                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
cber  Colwellia beringensis
Pathway
cber00071  Fatty acid degradation
cber00280  Valine, leucine and isoleucine degradation
cber00281  Geraniol degradation
cber00310  Lysine degradation
cber00362  Benzoate degradation
cber00380  Tryptophan metabolism
cber00410  beta-Alanine metabolism
cber00640  Propanoate metabolism
cber00650  Butanoate metabolism
cber00903  Limonene and pinene degradation
cber00930  Caprolactam degradation
cber01100  Metabolic pathways
cber01110  Biosynthesis of secondary metabolites
cber01120  Microbial metabolism in diverse environments
cber01130  Biosynthesis of antibiotics
cber01200  Carbon metabolism
cber01212  Fatty acid metabolism
Module
cber_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cber00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B5D82_10725
   00650 Butanoate metabolism
    B5D82_10725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B5D82_10725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5D82_10725
   00310 Lysine degradation
    B5D82_10725
   00380 Tryptophan metabolism
    B5D82_10725
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5D82_10725
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5D82_10725
   00281 Geraniol degradation
    B5D82_10725
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5D82_10725
   00930 Caprolactam degradation
    B5D82_10725
Enzymes [BR:cber01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B5D82_10725
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B5D82_10725
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     B5D82_10725
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     B5D82_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ZirS_C PDH
Motif
Other DBs
NCBI-ProteinID: ASP48188
UniProt: A0A222G8F8
LinkDB All DBs
Position
2507366..2509528
Genome map
AA seq 720 aa AA seqDB search
MLFQGKSLSAKLLDDGIVEFKFDAQGSVNKFDQATFKEYIAVVDAINNCNEAKGVLVTSG
KSSFIVGADITEFLETFKKSEDELLPWVKQASDVFDSFEDINLPTVVAINGFALGGGCEM
TLACDYRIADTTCSIGLPEVNLGLIPGFGGTVRLPRVLGADNAIEWMSTGRAFKAEQAMA
VGLLDAVVAPEHLREAAIKMLTQAIDGKLDWRAKRQPKLEALKLSPTESIMTFNTCKGMI
AAKAGKHYPAPMVMVKTIEAAAGLDRAGAMALENAGFAKLAKTDVATAQIGLFMADQVVK
GKAKKAAKQATKAVNKAAVLGAGIMGGGIAYQSAYKGTPIIMKDINDQALDLGLTTAAGI
LTKQVERGRMTAKKMAGVLNNITPSLSYDSVKDVDIVVEAVVENPKVKAMVLAEVENHVS
EDTIVTSNTSTISIDLLAQSLKRKDKFCGMHFFNPVNKMPLVEVIRGKETSDETVAAVVA
YAAKMGKSPIVVNDCPGFYINRVLFPYFAGFSQLVLEGADFTAVDKVMEKQFGWPMGPAY
LLDVVGIDTADHCTGVMSSGFPTRMGKIDNDPVSALYNSKRLGQKNGKGFYDYGKDKRGR
PTKVAAQAAYDLFAGVEKKDFSQDETIARLMIPMVNEVVRCLEEGVVDTAAEADMGLIYG
LGFPPFRGGPIRYLETLGLDNFIAMADKYAHLGEIYQVTDGMREMAKSGQSYFTTDVKTA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcaaggcaaaagcctttctgccaagttgttagatgatggcattgtcgaattt
aaattcgatgcacaaggctcagttaacaaatttgatcaggcaacgtttaaagaatatatc
gcagttgttgatgcgattaataattgcaatgaagcaaaaggggtactggttacttctggt
aagtcttctttcatcgttggtgctgatatcaccgagtttttagaaacatttaaaaaatct
gaagatgaattattgccttgggttaaacaagcttcagatgtttttgactcattcgaagat
attaatctacctacagttgtcgccatcaatggtttcgctttaggtggcggttgtgaaatg
acattagcgtgtgattatcgtattgctgataccacatgttcaatcggcttgccagaagta
aacttaggtttaatacctggctttggtggtacagttcgtttaccacgtgtacttggtgct
gataatgccattgagtggatgtcgacaggccgagctttcaaagctgaacaagctatggcg
gtaggattacttgacgccgtagttgcgccagagcatttgcgtgaagcggcaataaaaatg
ctaacgcaagctatcgacggtaaattagattggcgtgcgaaacgtcagcctaaactagaa
gcattaaagctttcaccaacagaaagcattatgacctttaatacgtgtaaaggcatgatt
gcagcgaaagctggtaagcattatccagcacctatggtgatggttaaaacgattgaggct
gccgcaggtttagaccgtgcaggtgcaatggcattagaaaatgccggctttgcaaaatta
gcgaaaaccgatgtagctacggcacaaattggcttatttatggctgatcaagtagtgaaa
ggtaaagccaaaaaagccgctaaacaagcgactaaagcagtcaataaagctgctgtattg
ggtgctggtattatgggtggtggtattgcttaccaatcagcctataaaggcacgccaatt
atcatgaaagatattaacgaccaagcgcttgaccttggcttaacaacggctgctggtatt
ttaactaagcaagttgaacgtggccgcatgaccgctaagaaaatggcaggtgtactgaat
aacatcacaccatcattaagttacgacagcgttaaagatgttgatattgtcgttgaggcg
gtagttgagaatccaaaagttaaagctatggtattggctgaagtggaaaaccacgttagc
gaagacactatagtgacttcaaatacctcgactatttcaattgatttactagcacaaagt
cttaaacgcaaagataaattttgtggcatgcatttcttcaacccagttaataaaatgcca
ttagttgaagtcattcgtggtaaagaaacctcagatgaaaccgttgctgctgttgtagcc
tacgctgcgaaaatgggtaaatcacctatcgtagttaacgattgtcctggtttttatatc
aaccgtgttttattcccatactttgccggctttagccaattagtgcttgaaggtgctgat
tttaccgctgtcgataaagtaatggaaaaacaattcggttggccaatgggccctgcatac
ttacttgatgttgtgggtatcgatactgcagatcattgtaccggtgttatgtcatcgggt
ttcccaacgcgtatgggtaaaattgataatgacccagtaagtgcgttatacaacagtaaa
cgtttaggtcagaaaaatggtaaaggcttttacgattacggcaaagataagcgcggtcgt
ccaactaaagtcgcggcacaagcagcttatgatttgtttgctggggttgagaaaaaagac
ttcagtcaagacgaaactattgctcgtttgatgatccctatggtcaatgaagtggtacgt
tgtttagaagaaggtgtggtggatactgcagctgaagctgacatgggcttgatatacggc
ttaggttttcctccatttagaggcggtccaattcgttatttagaaactctaggattagat
aactttattgccatggcagataaatacgcgcacttaggcgaaatttatcaagttactgac
ggtatgcgcgaaatggcgaaatctggtcagtcatattttacaacagacgttaaaacagct
taa

DBGET integrated database retrieval system