KEGG   Colwellia beringensis: B5D82_11430Help
Entry
B5D82_11430       CDS       T05628                                 

Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cber  Colwellia beringensis
Pathway
cber00250  Alanine, aspartate and glutamate metabolism
cber00410  beta-Alanine metabolism
cber00430  Taurine and hypotaurine metabolism
cber00650  Butanoate metabolism
cber01100  Metabolic pathways
cber01110  Biosynthesis of secondary metabolites
cber01120  Microbial metabolism in diverse environments
cber02024  Quorum sensing
Module
cber_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cber00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B5D82_11430
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B5D82_11430
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5D82_11430
   00430 Taurine and hypotaurine metabolism
    B5D82_11430
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B5D82_11430
Enzymes [BR:cber01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B5D82_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASP48321
UniProt: A0A222G942
LinkDB All DBs
Position
2679237..2680865
Genome map
AA seq 542 aa AA seqDB search
MTVNKRAAKVSEESLHRIFTIPVAPNSTLGRVESEISQNLAGFLGSHIAATEQALSEIEK
DFADSQIPEDPAFVSDHMHHLLDKLVSQSVHTSSPNFIGHMTSALPYFILPLSKLMIGLN
QNLVKIETSKAFTPMERQVLGMMHRLVYQDEEPFYQQWMHSANHSLGAFCSGGTVANLTA
LWVARNNLLKPDGDFKGVAREGLFKALKHYNYDGLAILVSARGHYSLKKSADVLGIGQDS
VIAIPTDENNKIDCQLLEEKCQQLARENIQVLSIVGVAGTTETGNIDPLDKIADIAQRYN
AHFHVDAAWGGATLLSNKYRPLLKGIELADSVTIDAHKQMYVPMGAGLVVFKNPASVAAI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYAALHVISRPGYELLINGSIEKANYFAQL
IEQHADFELVTKPELCLLTYRYNPSSVQKLLANASDVEQENINVLLDKLTEFIQKRQREN
GKSFVSRTRIEVQKYQGRKTLVFRVVLANPLTTKTILQDVLAEQAQLAQESERFLPLLLS
MS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaataaacgcgcagcaaaagtttctgaagagtctttacatcgtatttttacc
attcctgttgcacccaattctacattgggtcgcgtagagagtgagatatctcaaaacttg
gctggcttcctaggttcgcacatcgcagcgacagaacaagccttgagcgaaattgaaaaa
gattttgctgactcgcagatccctgaagatcctgcttttgtttcagatcacatgcaccac
ttacttgataagcttgtgtctcaatctgttcatacctcaagtccaaatttcatcggtcat
atgacctctgcattaccgtactttattttaccgttatcaaaactgatgattggcttaaat
caaaatttggtaaaaattgaaacgtcaaaagcatttaccccaatggaacggcaagtgctt
ggtatgatgcatcgtttagtttatcaagatgaagagccgttttatcaacaatggatgcat
agtgcgaatcactcattaggcgcattttgctcaggcggcactgtcgctaatttaacggca
ctttgggttgcacgtaataacttattaaaaccggatggtgattttaaaggtgtagcacgt
gagggcttattcaaggcacttaaacattataactatgacggcttagctatcttagtgtca
gctcgtggacattattcactgaaaaagtcggcagatgtcttaggtataggccaagacagt
gttattgctattccaaccgatgaaaataataaaattgactgccaactgcttgaagaaaaa
tgtcagcagttagcacgtgaaaatattcaagtacttagtattgtcggtgttgcaggcaca
acagaaaccggcaatatagacccgcttgataaaatagctgatatagctcaacgctataat
gcgcattttcatgttgatgctgcttggggtggagcaaccttattatcgaataagtatcgc
ccattattaaaaggcattgagttggctgactcggtcactatcgacgcacataaacaaatg
tatgtgccgatgggagcagggctagtggtatttaaaaacccggcctctgttgctgcgatt
gagcatcatgctgagtatattttacgcaaaggctcaaaagatttaggaagtcatacttta
gaaggttcgcgtccaggtatggcaatgttggtctatgccgctttgcatgtgatcagccgt
ccaggctatgaattgctgattaatggcagtattgaaaaagctaattattttgctcaatta
atcgagcagcatgctgattttgaattggttactaagcctgaactatgcttgttaacttat
cgctataatccaagtagtgtgcaaaagttgctggctaacgctagtgatgttgaacaagaa
aacattaacgtattgctggataagttgacagaattcatccaaaaaagacaacgtgaaaat
ggtaagtcttttgtttctcgtacccgtattgaagtacagaaataccaagggcgaaaaact
ttagtctttcgtgttgtattagcgaatccgctgaccacaaaaactattctacaagacgta
ttagctgaacaggctcaattggcgcaagaaagtgaacgctttttacccttattattgtcg
atgagctaa

DBGET integrated database retrieval system