KEGG   Colwellia beringensis: B5D82_14950Help
Entry
B5D82_14950       CDS       T05628                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cber  Colwellia beringensis
Brite
KEGG Orthology (KO) [BR:cber00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cber01002]
    B5D82_14950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cber04147]
    B5D82_14950
   04090 CD molecules [BR:cber04090]
    B5D82_14950
Enzymes [BR:cber01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     B5D82_14950
Peptidases [BR:cber01002]
 Metallo Peptidases
  Family M2
   B5D82_14950
Exosome [BR:cber04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5D82_14950
CD molecules [BR:cber04090]
 Proteins
  B5D82_14950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 RE_Bsp6I
Motif
Other DBs
NCBI-ProteinID: ASP48953
UniProt: A0A222GBD2
LinkDB All DBs
Position
complement(3556799..3558643)
Genome map
AA seq 614 aa AA seqDB search
MKPTFKLTTAAILVAASLSACNGDNTNINDTKAASPASKVLTVQDAEKFLAATEKELVQL
NTEGSRAAWINSNFITEDTSALAAAADQKSTEAGVRFAMQAAKFDSVDVNTDQRRKLNIL
KQSLVMPAPQDSAKSAELAKIGAELNSMYGKGNYTAKSGETLSLGQMTATMATSRDYDEL
LEMWQGWRTISPEMKPLYMRQVELGNEGAQGLGYADLGAMWRSNYDMSADEFAKELDRLW
GQVKPLYDDLHCYVRTELGKKYGEDNVPQNQPIPAHLLGNMWAQSWGNIYDLVAPENADP
GYDVTKQLAANNYDEIKMVKGAESFFTSLGFEALPETFWQRSLFTKPADRDVVCHASAWD
LDAKDDIRIKMCIQKTGEDFSVIHHELGHNFYQRAYQNQPVYYQNSANDGFHEAIGDTIA
LSVTPKYLKEIGLIDTIPDESKDIGLLMKMALDKVAFMPFGLMVDQWRWKVYSGEVTPEN
YNTAWWELREKYQGVSAPIERDINAFDPGAKYHVPGGVPYSRYFLAHIQQFEFHRALCEI
SGNTDPIHRCSIYNNKDAGTALNKVLEMGSSQPWQQAYKVLTGNEQMDATAIVDYFAPLH
TWLKDKNQGKQCGF
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaacatttaaattaaccacggcagctatcctagtagcagcaagcttaagtgct
tgtaatggtgacaacacaaacattaatgatactaaagcagcaagcccggccagcaaagta
ttaacggtacaagatgcagaaaaatttttagccgctaccgaaaaagagctagtgcaactt
aacactgaaggcagccgtgcggcgtggataaattcaaactttattactgaagacacctct
gcacttgccgcagcggccgatcaaaagtcaactgaagcgggtgtaagatttgccatgcaa
gccgctaagtttgattctgttgatgtgaatacagatcaacgtcgcaaactcaatatttta
aaacaaagtttagtgatgcccgcaccacaagattctgctaaatctgcagaattagctaaa
attggtgctgaattaaatagtatgtatggcaaaggaaattacacagctaagtcaggcgaa
actttaagtttagggcaaatgaccgcgacaatggccacctcacgtgattacgatgagtta
ttagaaatgtggcaaggttggcgaactatcagccctgagatgaaaccattatatatgcgc
caagtagaactgggtaatgaaggtgcacaaggtttaggctatgcagatttaggcgcaatg
tggcgctccaattacgatatgtccgcagatgagtttgcaaaagaacttgaccgtttatgg
ggacaagttaaacctttatacgatgatttacattgttatgtacgtactgaattaggcaaa
aaatacggcgaagataacgtaccacaaaaccaaccaatacccgctcatttactcggtaat
atgtgggcacaatcgtggggtaatatttatgacttagtcgcaccagagaatgccgatcct
ggctatgacgtaacgaaacaacttgccgctaataattacgatgaaattaaaatggtcaaa
ggcgctgaaagcttttttacctcacttggctttgaagcattaccagaaacattttggcag
cgctcgttatttactaagcccgccgaccgagatgtcgtgtgtcatgcttcagcctgggac
cttgatgctaaagatgatattcgtattaaaatgtgtatccaaaaaactggtgaagatttc
tcggttatacatcacgaactaggtcataacttttatcaacgtgcgtaccaaaaccagccg
gtatattaccaaaacagtgctaacgacggcttccacgaggccattggtgatactatagcc
ctttcagttacaccaaaatacttaaaagaaattggcttaattgacaccattcctgatgag
tcgaaagacattggtttactaatgaaaatggcattggataaagttgcttttatgccgttt
ggcttaatggttgatcaatggcgttggaaggtatattccggtgaagttacgccagaaaac
tataatacggcttggtgggaattacgtgaaaaataccaaggcgtaagcgcccctatcgaa
cgtgatataaatgcttttgaccccggtgcgaaatatcacgttcccggaggcgtaccttat
tcacgctacttcttagcacatatacagcaatttgaatttcatcgtgctttatgtgaaatt
tcaggtaacaccgatcctattcatcgttgttcaatttataacaataaagatgctggaacc
gcattgaataaagtactcgaaatgggctcaagccaaccatggcaacaagcttacaaagtg
ttaacgggtaacgagcaaatggatgcaaccgccattgttgattatttcgccccattacac
acctggctgaaagataagaaccaagggaaacaatgtggtttttaa

DBGET integrated database retrieval system