KEGG   Clostridium botulinum F Langeland: CLI_1285Help
Entry
CLI_1285          CDS       T00563                                 

Definition
(GenBank) glycosyl hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00010  Glycolysis / Gluconeogenesis
cbf00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_1285
   00500 Starch and sucrose metabolism
    CLI_1285
Enzymes [BR:cbf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CLI_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: ABS41205
UniProt: A7GCP1
LinkDB All DBs
Position
1350093..1351538
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYDIHP
IVTLSHYETPLHLSKVYDGWKSREMIGFFNKYVCTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIYQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWDTLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILKNTVDFISF
SYYMSICESSDKSIREGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELEDGTKTVLDDYRISYLRDHLIEVSEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaattttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcttggtcaagaatatttccaatgggggatgaaaaagaagcaaacgag
aaaggactacaattttatgatgatgtttttgatgagtgcttaaagtatgacatacaccca
atagtaacattgtcccattatgagactccattgcatttatctaaagtttacgatggatgg
aaaagtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcgatat
aaaaataaagtaaaatattggttaacttttaatgaaattaattcaattactcatgcacca
tttttaagcggtggaatttatacaccaatagaaaaattaagtaagcaagaaatttatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgtcatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggatacacttaataaagaaagagagaattttttcttttcagatatt
caagttcgtggttattatccctcatattcaaaaagattctttaaagaaaataatattaaa
ttagatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagtgataaatctattagggaaggtgagggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattgtatgatcgttatcaaaagccattattt
atagttgaaaatggattaggagctgtagatgaattagttgaactagaagatggaacaaaa
acagtattagatgactatagaatttcatatttaagagatcatttaattgaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttggggatgcattgatttggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatggaacagggacattagaacgctataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcactatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system