KEGG   Clostridium botulinum F Langeland: CLI_2002Help
Entry
CLI_2002          CDS       T00563                                 

Gene name
aor
Definition
(GenBank) aldehyde ferredoxin oxidoreductase, tungsten-containing
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00030  Pentose phosphate pathway
cbf01100  Metabolic pathways
cbf01120  Microbial metabolism in diverse environments
cbf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLI_2002 (aor)
Enzymes [BR:cbf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLI_2002 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N MTD
Motif
Other DBs
NCBI-ProteinID: ABS41790
UniProt: A7GEQ0
LinkDB All DBs
Position
complement(2119256..2121073)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEADHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVFNEGEAKKVSLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKGDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKIF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHRLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattatctattgaaaataaacttgtt
atagttactggtcctattactggagctcctatgccaaccagtggtagatatatggtagta
acaaaggctcctttaactgggactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggtacctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcagatcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgaaaataatgaaagagcaaaagtacta
tgtataggacctgcaggagaaaaactatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttctggaaaagttaaagtgtttaatgaaggggaagcaaaaaaagtatcc
ttagaaaaaattaaaatattaagagaagatccagttgcaggtggaggattacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtgcatcccgtgagaaacttc
caaaaatcctatacagatgaggctgataaaataagtggagaaactcttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcctgtggtagatgggtaaaatta
gatgatggtacagaatgtgggggcccagaatatgaaactttatggtcttttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
ctcgatacaatttcggcaggagctactattgcagcagccatggagttatacgaaaaagga
tatataaaggatgaggatataaaaggggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaagaaaatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctacggtgttccagagttttctatgacagttaaa
aagcaagaactaccagcctatgacccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaaatattc
cacgacttaacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggagtacaggattatgtagatatgtataatgtagtcgtaggtggtaagctacatgatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttcccatgatacccttccaaaaagattgcttaaagaacctattccg
gagggaccttctaagggatgtgttcatagattaagtgaattacttccagaatattatgca
gtaagaggatgggacaagaatggtataccaacagaagatacattgaaaaaattaggcctt
gaagaatatataaagtag

DBGET integrated database retrieval system