KEGG   Clostridium botulinum F Langeland: CLI_2331Help
Entry
CLI_2331          CDS       T00563                                 

Gene name
sodF
Definition
(GenBank) Mn/Fe superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbf  Clostridium botulinum F Langeland
Brite
Enzymes [BR:cbf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLI_2331 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABS41781
UniProt: A7GFM0
LinkDB All DBs
Position
complement(2481853..2482449)
Genome map
AA seq 198 aa AA seqDB search
MAHTLPNLNYDYNALEPHYDEQTLKIHHDIHHKVYVDGLNKAEQKLQEARESGDFALIKH
WEKEIAFHGSGHILHTLFWENMVPNGNLNPEGSAIERIKQDFGDYEKFKKQFTEAAIAVE
GSGWTILAWNPMFQKLVILQAEKHQNLTQWGVVPLLILDLWEHAYYLKYQNRRAEFINAW
WNIVNWDIVNTRYDNAIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcacatactttaccaaatttaaattatgattacaatgcattagaacctcattatgat
gagcagactttgaaaatacatcatgatattcatcataaagtttatgtagatggattgaat
aaagcggaacaaaagcttcaagaagctagagaatcaggagattttgcattaataaagcat
tgggaaaaggaaatagcatttcatgggtcaggtcacattttacatacattattttgggaa
aatatggtccctaatggaaatctaaatcctgagggatctgcaattgaaagaataaaacaa
gattttggagattatgaaaaatttaaaaaacaatttacggaagctgctatagcagtagaa
ggttcaggctggactattttagcatggaatcctatgtttcaaaaattagtaatattgcag
gcagaaaaacatcaaaatttaactcaatggggagtagttccactattaattttagattta
tgggaacatgcatattatttaaaatatcaaaatagaagggcagagtttattaatgcttgg
tggaatattgtaaattgggatatagtaaatactagatatgataatgctataaaataa

DBGET integrated database retrieval system