KEGG   Clostridium botulinum F Langeland: CLI_3557Help
Entry
CLI_3557          CDS       T00563                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00010  Glycolysis / Gluconeogenesis
cbf00030  Pentose phosphate pathway
cbf00051  Fructose and mannose metabolism
cbf00052  Galactose metabolism
cbf00680  Methane metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01120  Microbial metabolism in diverse environments
cbf01130  Biosynthesis of antibiotics
cbf01200  Carbon metabolism
cbf01230  Biosynthesis of amino acids
cbf03018  RNA degradation
Module
cbf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_3557 (pfkA)
   00030 Pentose phosphate pathway
    CLI_3557 (pfkA)
   00051 Fructose and mannose metabolism
    CLI_3557 (pfkA)
   00052 Galactose metabolism
    CLI_3557 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CLI_3557 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CLI_3557 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cbf01009]
    CLI_3557 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cbf03019]
    CLI_3557 (pfkA)
Enzymes [BR:cbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLI_3557 (pfkA)
Protein phosphatases and associated proteins [BR:cbf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLI_3557 (pfkA)
Messenger RNA biogenesis [BR:cbf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLI_3557 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABS41710
UniProt: A7GIW9
LinkDB All DBs
Position
complement(3711688..3712647)
Genome map
AA seq 319 aa AA seqDB search
MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDI
IQRGGTILRTARCEEFRTEQGREKAAKILKAFGIDGLVVIGGDGSFHGAQLLSKLGINTV
GLPGTIDNDLAYTDYTIGFDTSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYT
GVAGGAESIIIPEKEYNADKLCKQILQGKLKGKMHNLVLLAEGVGGANELAKYIEEVTGI
ETRSTILGHIQRGGSPTCMDRILASRMAYKAVELLISGKSSRVVGIKNGKIIDMDIDEAL
AVERSFDQELYDIATILSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatagctgtattaacaagtggtggagatgcaccaggaatgaatgctgctatc
agagcagtagttagaacaggtttagaaaaaggtttaaaagtaatgggaattcaaagagga
tataacggacttataaatggagaaatatttgaaatggatactcatagcgtatctgatata
atacaaagaggcggaactatattaagaacagctcgttgtgaagaatttagaacagagcag
ggaagagaaaaagctgctaaaatattaaaagcctttggtattgatggattagttgtaatt
ggtggagacggttcttttcatggggcccaattattatctaagttaggaataaatactgtt
ggactaccaggtactatagataatgatttagcttatacagattatacaattggctttgat
acatctataaatacagttttagatgctataaataagcttagagatacatccacttctcat
gaaagagtaagtgtagtagaagttatgggaagaaattgtggagatatagcattatataca
ggagtagctggtggagcagaaagtattataataccagaaaaagagtataatgcagataaa
ttatgcaaacaaatactacaaggaaaattaaaagggaaaatgcataacttagttttatta
gcagaaggtgttggaggagctaatgaactagcaaaatatatagaagaggttacagggata
gaaacaagatctacaatattaggacatatacaaaggggtggaagtccaacttgtatggat
agaatattagcttcaagaatggcttataaggcagtagaattattgattagtggtaaatct
tcaagagtagttggtataaaaaatggaaaaataattgatatggatatagatgaagcttta
gcagtagaaagaagttttgaccaagaattatatgacatagcaactattttatccaaataa

DBGET integrated database retrieval system