KEGG   Coxiella burnetii CbuG_Q212: CbuG_0044Help
Entry
CbuG_0044         CDS       T00787                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CbuG_0044
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbg03400]
    CbuG_0044
Enzymes [BR:cbg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CbuG_0044
DNA repair and recombination proteins [BR:cbg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CbuG_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACJ17503
LinkDB All DBs
Position
39044..41491
Genome map
AA seq 815 aa AA seqDB search
MILLSLKHYRQKRDFTKTSEPQGESASSSQQFIYVIQKHDASHLHYDLRLELDGVLKSWA
VPKGPSLNSDLKRLAVEVEDHPIDYATFEGNIPKGQYGAGPVIVWDKGTWQPEGNAKENL
KKGKLVFIINGEKLKGKWALVRLKTDDSKNNWLLIKKKDHYATERFDIDNYPLSVISGAS
IEEIKNHKLALSLSDLKNAKKTVVPEFIQPQLAKLKTVVPDSPDWIHEIKFDGYRIICII
KKGIIQLMTRNQKNWTEKLAGLAETMKSIPIDESILDGEIVVFDESGKTDFQLLQNAIKA
KKYNEIKYYLFDIPFCQKFDLSQVPLIMRKRLLKKLILQWKEKSGSILYSSHIKGNGKAI
LERACELGLEGIISKKIDAAYEQRRSSSWIKLKCKRQQEFVIGGYTKPRGEQLYFGALLL
GYYQNKKLIYCGRVGTGFSSLSLKDIYEKLINREQKAPAFSELPPFGIKAGNHWVKPELV
AEIEFAEWTKDKRLRQPVFKGLREDKEAKGVKLETVKKTTVKNKSNNIKLTNPEKILYPE
EKITKRQLADFYSKIADRLLPHIVHRPLMLLRCPNGYNKECFFQKHPDQNGEEFVYSVEI
EEKERKRYLTIHDEKGLLALVQMGVLEIHPWGSSDSHPEKPDRLIFDIDPHPAVSWKAVI
NCATDVFEVLKALGLRSFVKTSGGKGLHVYVPIQPQLGWEKLHEFAQKLAKLIVQVNPRL
YTAELSKGKRLNKIFIDYIRNNRGATCVAPYSTRAKKHVPLSTPVSWDELSAVKSPTQFT
IKNIFHRLEALNQDPWEEFFDIKQSITASMWKFFS
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
gtgattctgttgagcctgaaacattatcgccaaaaacgagattttaccaaaacctccgaa
cctcagggggaaagtgcttcctctagtcaacagttcatttacgtgattcaaaaacacgat
gcttcacatttgcattacgaccttcgcttagaattagacggtgtactgaaaagctgggcg
gttcctaaagggccttccttaaattctgatctaaaacgattagctgtcgaagtggaggac
catcccatcgattacgccacttttgaaggtaatatccctaaaggacaatatggtgcgggt
ccggttattgtttgggataaaggtacctggcagcccgaagggaatgcaaaagagaattta
aaaaaaggaaagctcgtctttattattaatggtgaaaaattaaagggaaaatgggcgcta
gtaaggcttaaaaccgacgattctaagaataattggctattaattaaaaaaaaagatcat
tatgccaccgaacgttttgatatcgataattatccattaagcgtaatcagtggcgcttcc
atagaagaaattaaaaatcacaaacttgccctatcgctaagcgacttaaaaaatgcaaaa
aaaacagtagttcctgaatttatccaaccgcaactcgctaaattaaagacagttgtgccc
gattcaccggattggattcacgagattaaatttgatggctatcgaatcatttgtattatt
aaaaaaggaattattcaattaatgacacgaaatcaaaaaaactggactgaaaaattagcc
gggcttgcagaaacgatgaaatcaatacctatcgatgagtcaatactggatggagaaata
gttgttttcgatgaatcggggaaaacagatttccagcttctgcaaaatgccatcaaagcc
aagaaatacaatgaaataaaatattatctctttgatattcctttttgccagaaatttgat
cttagccaagtgccattgataatgagaaaacgattattaaaaaagttaattttacaatgg
aaagaaaaaagtggaagcatactttattccagtcatataaaaggaaatggaaaagctatt
ctagaacgtgcttgcgagttgggtttggaaggaattatttccaaaaaaatcgatgctgct
tatgagcaacgaagaagctctagttggataaagctcaagtgtaaacgacagcaagaattc
gtgattggtggctatacaaaaccgcggggagaacaactctattttggcgctttattatta
ggctattatcaaaataaaaaattaatttattgtgggagggttggcactgggtttagcagt
ctatcgttaaaagatatttatgaaaaattaataaatcgcgaacaaaaagcccccgctttt
tctgagttacctccttttggaataaaagcaggcaatcattgggtaaaacccgaattagtg
gctgagattgaattcgctgagtggacgaaagataaacgtttgaggcagccggtttttaaa
gggttgcgtgaagacaaggaagctaaaggagttaaattagaaacagttaaaaaaacgaca
gtcaaaaataagtctaataatattaaattaaccaaccctgaaaaaattctataccccgaa
gaaaaaattacgaaacgccagttggcggatttttatagcaaaatagccgatcgcttactg
cctcacatcgttcaccgcccgttgatgctgcttcgttgtccgaatggctataacaaagaa
tgtttttttcaaaaacatcctgatcaaaatggcgaggaatttgtttatagcgttgaaata
gaagaaaaagagagaaaaaggtatctgacgattcatgatgaaaaaggccttcttgcatta
gttcaaatgggcgtcttggaaattcacccgtggggcagcagcgattcgcatccggaaaaa
ccagaccgattaatttttgatattgatccgcatccggcggtcagttggaaagccgtgatt
aattgcgcgactgatgtttttgaagtattgaaggctttgggtttgcgaagttttgttaag
acttctggaggaaaagggttgcacgtgtacgttcctattcagccgcaattgggttgggag
aaactgcatgaattcgcgcagaagttggctaaattaattgttcaggttaatccacgtctt
tatacagctgaattgagtaaaggaaaacggctcaataaaatatttatcgattatattcga
aataaccgaggcgccacttgtgtggcgccttatagcacccgagcaaaaaagcatgtccct
ctttccaccccggtttcctgggatgaattgtcagcggtaaaatcccctacccaatttacg
ataaaaaatatattccatcgcctggaggcattaaaccaagacccttgggaggagtttttc
gacataaaacaatcaatcactgcctcgatgtggaaattttttagttaa

DBGET integrated database retrieval system