KEGG   Coxiella burnetii CbuG_Q212: CbuG_0612Help
Entry
CbuG_0612         CDS       T00787                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00020  Citrate cycle (TCA cycle)
cbg00190  Oxidative phosphorylation
cbg00650  Butanoate metabolism
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
Module
cbg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuG_0612 (sdhA)
   00650 Butanoate metabolism
    CbuG_0612 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CbuG_0612 (sdhA)
Enzymes [BR:cbg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CbuG_0612 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CbuG_0612 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACJ18021
LinkDB All DBs
Position
573327..575090
Genome map
AA seq 587 aa AA seqDB search
MSSIRVKQYDALIVGAGGAGLRAALEMAQSRQYKVAVVSKVFPTRSHTVSAQGGIAAALG
NVVPDKPIWHMFDTVKGSDYLGDQDAIQYMCEQAPPSVYELEHYGLPFSRLDDGRIYQRA
FGGHTRDFGKEMARRTCACADRTGHAMLHTLYQKNVEAGTHFYYEWYGIDLVRGAQGGIA
GMIAMNMETSELVFFKSRATIFATGGAGRIYETTSNAYTNTGDGIGMVLRAGLPVQDMEF
WQFHPTGIYGVGCLITEGARGEGGYLINKDGERFMERYSPHLKDLDCRDVVARSILQEVM
AGGGVGPKKDHVLLKLDHLGEKVLRERLPGIIELSEKFANVDITKEPIPILPTCHYMMGG
IPTNIHGQALTVDENGKDQIIEGLFAAGECACVSVHGANRLGTNSLLDLVVFGRAIGLHL
EEALKTELKHRSENPDDIGAAIARLKRWEKPDNVENPALLRQEMRKAMSEDFGVFREEQK
MKQGLERLQKLNERLQRAKLTDTSRTFNNARIEALELDNLMEVSYATAVSAQQRTESRGA
HSRYDYKERDDANWLKHTVYFRDGHIAYRPVNMKPKGMDPFPPKSRD
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagctctattagagtcaaacaatacgatgctctcatcgtaggagcgggcggggcgggc
ctacgcgccgcattggaaatggcgcaatctcgtcagtataaagtcgccgttgtatcaaaa
gttttccccacgcgatcgcacaccgtttccgcgcaaggtggcatagcggccgctttgggc
aatgtggtgccggataaaccgatttggcatatgttcgatacggttaaaggatcggactac
ttaggcgatcaagacgccattcaatacatgtgtgaacaggccccgccttccgtgtacgaa
ttggaacattacggacttcccttttcgcgattggatgacggtcgcatctatcaacgcgct
tttggcggccacacgcgcgatttcggtaaagaaatggctcggcgcacatgcgcctgtgca
gaccgaaccggtcatgccatgctccatacgttgtaccaaaaaaatgtagaagcaggtacc
catttttattatgaatggtatggaatcgatttagttcgcggtgcacaaggcgggattgcc
ggcatgatcgcaatgaatatggaaaccagtgagttggtttttttcaaatcacgagcgacg
attttcgccaccgggggagcgggccgtatttatgaaacaaccagtaacgcttataccaac
acaggtgatggaattggtatggtgttgcgagctgggttacccgtgcaagacatggagttt
tggcaattccatccgacgggtatttacggtgtgggttgtttgattacagaaggcgcgcgt
ggtgagggcggttatcttattaataaagacggtgaacgttttatggaacgttattctccg
catttaaaagacctcgattgccgcgacgtcgttgcccgttctatcttacaagaagtcatg
gccggcggtggcgttggcccgaaaaaagatcacgtcttacttaaattggatcatttggga
gaaaaagtattacgagagcggctccctggtatcatcgaattatccgaaaaatttgcaaac
gtcgatatcacaaaagaacccatccctattttaccgacctgccattacatgatgggtggc
attcccaccaatattcatggtcaggcgctcacggtggatgaaaatggtaaggatcaaatt
atcgaaggcctgtttgccgcgggagaatgcgcgtgtgtttctgttcatggggcaaatcgg
ttagggactaattcattattagacttagtcgtctttggtcgtgccattgggttgcattta
gaagaggccttaaaaaccgaattgaaacatcgttctgaaaatcccgatgatattggtgct
gccatcgctcgcctaaaacgctgggaaaaacccgataacgttgaaaatcccgcattactt
cgacaggaaatgcgaaaagctatgtcggaagacttcggcgtgttccgcgaagagcagaaa
atgaagcaggggctggaacgtctgcaaaaattgaatgaacggttacagcgcgcgaaatta
accgataccagtcgcactttcaacaatgcccgaattgaggccttagaactcgataattta
atggaagtctcttacgctaccgccgtttcagcgcagcagcgtacggaaagccgaggcgct
cattcccgttatgattataaagaacgcgacgatgcaaattggctgaaacacaccgtttat
tttcgcgacgggcacatcgcttaccgccctgtcaatatgaaacccaaagggatggacccg
tttccccctaaatcgagagattga

DBGET integrated database retrieval system