KEGG   Coxiella burnetii CbuG_Q212: CbuG_0613Help
Entry
CbuG_0613         CDS       T00787                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00020  Citrate cycle (TCA cycle)
cbg00190  Oxidative phosphorylation
cbg00650  Butanoate metabolism
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
Module
cbg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuG_0613 (sdhB)
   00650 Butanoate metabolism
    CbuG_0613 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CbuG_0613 (sdhB)
Enzymes [BR:cbg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CbuG_0613 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CbuG_0613 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Acetone_carb_G Fer4_9
Motif
Other DBs
NCBI-ProteinID: ACJ18022
LinkDB All DBs
Position
575097..575828
Genome map
AA seq 243 aa AA seqDB search
MNSKKSRIMTFSIMRFNPETDKKPYMQDFELDVSAIQGKMLLNALEALREKHPDIGLRRS
CAEGVCGSDGMNINGKNALACVTQLKDLPDRVVVRPLPGFPIIRDLIVDMEQFYAQYKKV
KPYLLNDQEAPQKERLQSPEERAKLDGLYECILCACCSSSCPSYWWNPDKFIGPAGLLWS
YRFIADSRDSKEKERLDAMKDPYSVFRCRTIMDCATVCPKNLNPAKAIRKIRTEMLQETE
SGE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaaaaatcacgaatcatgactttctcaattatgcgctttaatccagaaacg
gataaaaaaccttacatgcaagattttgaattggatgtttctgccattcagggaaaaatg
ctactcaatgctttagaagcccttcgagaaaaacaccccgatatcggtttgcgacgttcg
tgtgcggaaggcgtttgtggctcggatggaatgaatatcaatggcaaaaatgccttagct
tgcgtgacccaattaaaagatttgcccgaccgtgtcgtcgttcgaccattgccgggcttt
cctattattcgtgatttaattgtggatatggagcagttttatgctcaatataaaaaagtg
aaaccttatcttttaaatgatcaggaggctcctcaaaaagagcggctgcaaagtccagaa
gaacgggctaaattagatggattatacgaatgtattttatgcgcctgttgttcttcttct
tgtccttcctattggtggaatccagacaaatttattggaccggcgggtttattatggtcg
tatcggtttattgcggatagtcgcgactccaaggaaaaagaacgcctcgatgcaatgaag
gacccctacagtgtttttcgttgtcgtaccattatggattgcgcgacggtatgccctaaa
aatcttaaccctgctaaagcaatccggaaaatccgcaccgaaatgcttcaggaaacagaa
agcggggaataa

DBGET integrated database retrieval system