KEGG   Coxiella burnetii CbuG_Q212: CbuG_0670Help
Entry
CbuG_0670         CDS       T00787                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00473  D-Alanine metabolism
cbg00550  Peptidoglycan biosynthesis
cbg01100  Metabolic pathways
cbg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CbuG_0670
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CbuG_0670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CbuG_0670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbg01011]
    CbuG_0670
Enzymes [BR:cbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CbuG_0670
Peptidoglycan biosynthesis and degradation proteins [BR:cbg01011]
 Precursor biosynthesis
  Amino acid ligase
   CbuG_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ACJ18073
LinkDB All DBs
Structure
PDB: 

Position
639821..640942
Genome map
AA seq 373 aa AA seqDB search
MMAEKLHISVLCGGQSTEHEISIQSAKNIVNTLDAAKYLISVIFIDHVGRWYLIDQPEMF
LAYSPDHLVKEGSARPITIAFGDAAKPWQSLNGDGRRYSADCVFPMVHGTQGEDGALQGL
LELLNLPYVGANVQSSAVCMEKDLTKTVLRAGGIPVVDWHTLSPRDATEGVYQRLLDRWG
TSELFVKAVSLGSSVATLPVKTETEFTKAVKEVFRYDDHLMVEPRIRGREIECAVLGNGA
PKASLPGEIIPHHDYYSYDAKYLDPNGATTTTSVDLSGSVTKQIQQIAIDAFKMVHCSGM
ARVDFFVTPNNKVLVNEINTIPGFTNISMYPKMWEASGLPCPNLLDQLIELAIDRHQEQQ
KLIRCYEVKARSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgatggcagaaaaattacacatttcagtgctttgtggaggacagtctactgaacatgag
atttctattcagtcagcaaagaatattgtaaacaccttggatgctgccaagtatttgatt
tctgtgatttttattgaccatgtgggtcgatggtatttgattgaccaaccggaaatgttt
ttagcgtattcgcctgaccatctggtcaaagaggggagcgcacgaccgattactattgct
tttggagatgctgcaaagccttggcagtcgttaaacggcgatggacgccgttattcggca
gattgtgttttccccatggttcacgggacccagggagaggatggagctttgcaggggttg
ttggagcttttaaatttgccgtatgtgggcgcgaatgtgcaaagttctgcggtttgtatg
gaaaaggaccttaccaaaacggtgcttcgagcgggtggaattcctgtggtggattggcat
acgctttcaccccgagatgccacagaaggtgtgtatcagcgacttctcgatcggtggggt
acgtctgagttatttgtgaaagcggtgagtttaggttcgtcagtagcgactttgcccgta
aagacagaaacagaatttacaaaagcggttaaggaagtttttcgttatgacgatcacctg
atggttgagccgcggattcgcggacgggaaattgagtgtgctgttttggggaatggagct
ccaaaagcttctttgcccggtgaaattattcctcatcacgattattattcgtatgacgcg
aaatatctcgatcctaacggcgctacaacgacaacgtctgttgacttatcgggatcagtg
actaaacagattcagcaaatagccatcgatgcttttaagatggtgcattgttcggggatg
gcacgggtggatttttttgttacgccaaacaataaagtcctggtgaatgaaataaatact
attcctggatttacgaacattagtatgtatccaaaaatgtgggaagccagcggattgcct
tgtccgaatttgttggatcaattaattgaattagccattgaccgccaccaagagcagcag
aaattgatacggtgttatgaagtaaaggcaaggagtttgtaa

DBGET integrated database retrieval system