KEGG   Clostridium botulinum A Hall: CLC_1151Help
Entry
CLC_1151          CDS       T00575                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00010  Glycolysis / Gluconeogenesis
cbh00053  Ascorbate and aldarate metabolism
cbh00071  Fatty acid degradation
cbh00280  Valine, leucine and isoleucine degradation
cbh00310  Lysine degradation
cbh00330  Arginine and proline metabolism
cbh00340  Histidine metabolism
cbh00380  Tryptophan metabolism
cbh00410  beta-Alanine metabolism
cbh00561  Glycerolipid metabolism
cbh00620  Pyruvate metabolism
cbh00625  Chloroalkane and chloroalkene degradation
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01130  Biosynthesis of antibiotics
Module
cbh_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLC_1151
   00053 Ascorbate and aldarate metabolism
    CLC_1151
   00620 Pyruvate metabolism
    CLC_1151
  Lipid metabolism
   00071 Fatty acid degradation
    CLC_1151
   00561 Glycerolipid metabolism
    CLC_1151
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLC_1151
   00310 Lysine degradation
    CLC_1151
   00330 Arginine and proline metabolism
    CLC_1151
   00340 Histidine metabolism
    CLC_1151
   00380 Tryptophan metabolism
    CLC_1151
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLC_1151
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CLC_1151
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLC_1151
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CLC_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 5399087
NCBI-ProteinID: YP_001387018
UniProt: A5I0U1
LinkDB All DBs
Position
1181469..1182839
Genome map
AA seq 456 aa AA seqDB search
MENIRNILEKQKSFFDKGYTKDINFRIEALKKLKHNIKINENNIFKALKIDLNKSEFETF
ITEIGIVYDEINGAIKNIKKWSKPKKVKTPITNFLASSYIYNEPYGVALIMSPWNYPFQL
IMAPLVGAISAGNCVLLKPSELAIETEKIIVKIIKDTFSDEYIGVITGGIEESTALLKEK
FDYIFYTGGINVGKIVMRAAAEHLTPITLELGGKSPCIVDKDANIDLAARRIAWGKFLNA
GQTCVAPDYLVVHRNIKEKLISSIENYIIEFFGENTFESEDYPRIINERHFKRLEGYLKE
GKIVSGGNTDINNLYIEPTIIEGINFENRIMEEEIFGPVFPVIEFENIDKVIEIVKNNPK
PLALYYFSENKEKQEFIIKNISFGGGCINDTIMHLSTSTLPFGGVGNSGIGGYHGRASFD
TFSHKKSILKKSNLIDVKIRYAPFKGKINLAKRLFK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggagaatataagaaatatattggaaaaacagaagagtttttttgataagggatataca
aaggatattaactttagaatagaggctttaaaaaaattaaaacataatataaaaatcaat
gaaaacaatatatttaaagctttaaagatagatttaaataaatcagaatttgaaacattt
ataacagaaataggtattgtatatgatgaaataaatggagcgattaaaaatataaaaaaa
tggtcaaagcctaaaaaagtaaaaactccaattactaattttttagctagtagttatata
tacaatgagccttacggtgtagctttaataatgtctccctggaattatccatttcaactt
attatggctcctttagtaggagctataagtgctggtaattgtgttttgttaaagccctcc
gaattagcaatagaaacggaaaaaataatagttaaaataataaaagatacattttctgat
gaatatataggggttatcactggaggaatagaagagagtacggctttgcttaaagaaaag
tttgactatatattttatacgggtggaataaatgtaggtaaaatagttatgagagcagct
gcagagcatttaacccccataaccttagaattaggagggaaaagtccctgcattgttgac
aaggatgctaacatagatttggctgccagaagaatagcttggggaaaatttttaaatgct
ggacaaacctgtgtagcaccagattatttagtagtgcatagaaatataaaagaaaaatta
ataagttcaatagaaaattatataattgagttttttggagaaaatacctttgaaagtgaa
gattatcctagaataataaatgaaagacactttaaaagattagaaggatatttaaaggaa
ggaaaaatagtttctggaggaaatacagatataaataatttatatatagaaccaactatt
atagaaggaataaattttgaaaatagaataatggaggaagaaatatttggccctgttttc
ccagttatagaatttgaaaacatagataaagttatagaaatagtaaaaaataatcctaaa
ccactagcactatattatttttctgagaataaagagaaacaggaatttattattaaaaat
atatcctttggcgggggatgtataaatgatactataatgcatttgtctacttctacatta
ccctttggtggtgtaggtaatagtgggataggaggctatcatggcagagcaagttttgac
acattttctcataaaaaaagtatacttaaaaagagtaatttaatagatgtaaaaataaga
tatgcaccttttaaaggaaaaataaatttagcaaaaagattatttaagtaa

DBGET integrated database retrieval system