KEGG   Clostridium botulinum A Hall: CLC_1394Help
Entry
CLC_1394          CDS       T00575                                 

Definition
(RefSeq) peptide/opine/nickel uptake ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLC_1394
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbh02000]
    CLC_1394
Transporters [BR:cbh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CLC_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 AAA_21 AAA oligo_HPY MIT_C NACHT AAA_29 TniB AAA_23 ResIII AAA_5 ATPase
Motif
Other DBs
NCBI-GeneID: 5400369
NCBI-ProteinID: YP_001387259
UniProt: A5I1J2
LinkDB All DBs
Position
1453026..1453820
Genome map
AA seq 264 aa AA seqDB search
MNILEVKGLRIEEEKNKKILVGNTNFEVEKGKITCIVGESGSGKTITAMSIIGMLPQGVR
VIEGEILFNGKNTFNFSKEKLRDFRGKKIFSIFQNSINCFNPSVIMETQIYNMICSHYSI
DKENFRNKLINIMKNINLKNPEIILKQYPFQLSGGMLQRMMIASAILMEPDIIIADEPTT
ALDLTSQKDILNQLKMIKEKLNTTILMITHDFGVVAEIADNVIIMQNGNIIEKGNVYNIF
DNPQENYTKTLINATFKREVTYVC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattttagaagtcaaaggccttaggattgaagaagaaaaaaataaaaaaatttta
gttgggaatactaattttgaagtagaaaaaggaaagattacttgtatagtgggagaaagt
ggaagtggcaaaactattacagccatgtccataataggaatgcttccacaaggagttagg
gttatagagggagaaatactttttaacgggaaaaatacttttaatttctctaaagaaaaa
ttaagagattttagaggaaagaaaattttttctatatttcaaaattctataaattgtttt
aatccctctgtaattatggaaacacaaatatacaatatgatatgtagtcattatagtata
gataaggaaaattttagaaataaacttataaatataatgaaaaatattaatttgaaaaat
cctgaaatcatattaaaacagtatccttttcaattaagtggaggtatgcttcaaaggatg
atgattgcatcagctatacttatggaaccagatataataatagcagatgaaccaactact
gccttggatttaacatctcaaaaagatatactaaatcaattgaaaatgataaaggaaaaa
ttgaatactactatattaatgataactcatgattttggagtagtagcggaaattgcagat
aatgtgataattatgcaaaatggaaatattatagaaaagggaaatgtatataatatattt
gataatcctcaagaaaattatactaaaactttaataaatgctacctttaaaagagaggta
acttatgtatgttag

DBGET integrated database retrieval system