KEGG   Clostridium botulinum A Hall: CLC_1881Help
Entry
CLC_1881          CDS       T00575                                 

Gene name
aor
Definition
(RefSeq) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00030  Pentose phosphate pathway
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
cbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLC_1881 (aor)
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLC_1881 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N MTD DUF2291
Motif
Other DBs
NCBI-GeneID: 5400593
NCBI-ProteinID: YP_001387736
UniProt: A5I360
LinkDB All DBs
Position
complement(1989955..1991772)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEAEHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNGEEAKKISLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKIF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHNAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattgtctattgaaaataaacttgtt
atagttacaggccctattactggagctcctatgccaacaagtggtagatatatggtagta
acaaaggctcctttgactgggactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggttcctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcagagcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaacaatgaaagagcaaaagtacta
tgtataggacccgcaggagaaaagttatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttctggaaaagttaaagtagtcaatggagaggaagcaaaaaaaatatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtggaggactacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcttatacagatgaggctgataaaataagtggagaaacccttacagaggattgc
cttgtaagaaaaaatccatgttatagatgtccaatagcctgcggtagatgggtaaaatta
gatgatggcacagaatgtggaggcccagagtatgaaactttatggtcctttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagctatggaattatacgaaaaagga
tatataaaagatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaaaaagatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctatggtgttccagagttttctatgacagttaaa
aagcaagaattaccagcctatgacccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcttatgctaaaatattt
cacgatttaacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagttacataatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttcccatgatacccttccaaaaagattgcttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatactatgca
gtaagaggatgggacaagaatggtataccaacagaggatacattaaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system