KEGG   Clostridium botulinum A Hall: CLC_3341Help
Entry
CLC_3341          CDS       T00575                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00473  D-Alanine metabolism
cbh01100  Metabolic pathways
cbh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLC_3341 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CLC_3341 (alr)
Enzymes [BR:cbh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLC_3341 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cbh01011]
 Precursor biosynthesis
  Racemase
   CLC_3341 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 5401733
NCBI-ProteinID: YP_001389121
UniProt: A5I7C2
LinkDB All DBs
Position
complement(3510870..3512030)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDLDNLQHNLKQIKKICGNKEIIGVIKANAYGHGAMEIAPTLLENGVSR
LAVAVLSEAMELRMSGVKEPIMILGYTPWALGDMLLDNDIEQSVYSYNDALELSKIAVLK
RKILKIHIVVDTGMGRIGFLPTKESVEDVYKISKLPNIEIEGIFSHFSSADESDKDYTLY
QMNKYNAFINKLEEKNIQVPIKHIANSAAIIDLENTHLDAVRAGIIMYGYYPSNYVLRNN
INLKPVMSLKTSIVHIKKVSSGEYISYGRTFKTKRESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTFIENLKVGDVVTIMGEENGVSYTAEDIASQIGTISYE
VICNVNKRVPRVYKKDGKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaatcgatctagataatttacaacataac
ttaaaacaaataaaaaaaatatgtggaaataaagagataataggggttataaaggctaat
gcatatggacatggagccatggaaatagcccctactcttttagaaaatggagtaagtaga
ttagcagtggcggttttaagtgaggctatggagcttagaatgagtggagtaaaggagccc
attatgatattaggttatacaccatgggctttaggagatatgcttttagataatgatata
gaacaatctgtatactcttataatgatgctttagaattatctaaaatagcggtgctaaaa
agaaaaatattaaaaatacatatagtggtagatactggcatggggagaattgggttttta
cctacaaaagaaagtgtagaagatgtatataaaataagtaagttgcctaatattgaaata
gaagggatattttctcatttttcttctgctgacgagtcagacaaagattatactttgtat
caaatgaataagtacaatgcatttataaacaaattagaggagaaaaatattcaagtacct
ataaagcatattgctaatagcgcagctataattgatttagaaaatactcatttagatgca
gtaagagcgggtattataatgtatggatactatccgtccaattatgtactaagaaataat
ataaatctgaaaccagtaatgtctttaaaaaccagtatagtacacataaaaaaagtatct
tcgggagaatatataagttatggcagaactttcaaaacaaagagagaaagcataatagct
accttacctataggttatgcagatggatataatagattattaagcaataaaggaaaagtt
atagttaacggcaaacttgctccagtaataggaagagtttgtatggatcaatgtatgata
gatgtaacttttatagaaaatttaaaagtcggagatgtggttacaattatgggggaggaa
aatggagtaagctatactgcagaggatatagcatcacaaataggcactataagttatgaa
gttatatgtaatgtaaataagagggtaccaagagtatataagaaggatggcaaaattata
aatgtagtaaactacatataa

DBGET integrated database retrieval system