KEGG   Clostridium botulinum Ba4: CLJ_B1243Help
Entry
CLJ_B1243         CDS       T00895                                 

Definition
(GenBank) beta-amylase
Organism
cbi  Clostridium botulinum Ba4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_20 Glyco_hydro_42 DUF1410
Motif
Other DBs
NCBI-ProteinID: ACQ52511
LinkDB All DBs
Position
1282809..1284437
Genome map
AA seq 542 aa AA seqDB search
MYYGNKILKKYGNFILSLVLAFALSLCFTFKAFAANMSPDYKCCVMGPLEKVDNWSDFKK
QLITLKNNGVYAITTDVWWGYVESEGDNKFDWSYYKTYGDTVRAAGLKWIPIISTHECGS
NVGDSVNIPLPSWLWEKDTADNMKFKDENGVYSKETLSPWWSDTVKQYDELYESFASNFS
SYKDIIAKIYLSSGPAGELRFPSYNPSTGWSRGFLQCYTKAAKLDFQNAMKNKYYTISRL
NSEWGTSLKSFEQVSPPTDGDNFFVNGYKTNYGNDFLTWYQGVLIKHLSNIATKAHNRFD
PVFGVTIGAKVSGVHWLINSPNMPHAAEYCTGYYNYSTLLDQFKKSNLDLTFTCLEKDDS
NPYNYPYSAPKSLVINIANLAREKGIKYFGENASDIYNNKKAYENCAEMLFNYNFSGFTL
LRLKNIVNYDGTPTTEMAPFADILAIKPVPVTFTVNNVNLESDENLYLTGSRWEMANWST
EFYPLQFKNNNGSYTITTHLAEGHNYEFKAIKKNNNGNVIWQGGYNQFYNVSKGGDSYTW
SW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtattatggtaataaaattttaaaaaaatatggaaattttattttatctctagtgtta
gcttttgctttaagtctgtgttttacatttaaagcttttgcagcaaatatgagccctgat
tataaatgttgtgtaatgggcccattagagaaagtggataattggagtgattttaagaag
caattaataactcttaaaaataatggagtttacgctattactacagatgtatggtgggga
tatgttgaaagtgaaggtgataataagtttgactggagttactacaaaacttatggggat
actgttcgtgctgcaggattaaagtggatacctattatatcaactcatgaatgtggtagt
aatgtaggtgattctgtaaatatacctttgccttcatggttatgggaaaaagatactgct
gataacatgaaatttaaggatgaaaatggagtttatagcaaagagactcttagtccatgg
tggtctgatacagttaaacagtatgatgagctttatgaatcatttgcctcaaattttagt
tcatataaagatattatagcaaaaatatatctttcatctggaccagcaggtgaattaaga
tttccatcttataatccatcaacaggctggtctcgtggatttttacaatgttatactaaa
gcagctaaattagatttccaaaatgctatgaaaaataaatattatactatatctagactt
aatagtgaatggggaacaagcttaaagagctttgaacaagtcagtcctccaactgatgga
gacaatttttttgtaaatggatataaaacaaactacggcaatgatttcttaacttggtat
caaggtgtgcttataaaacatttatcaaatatagcaactaaagcacataatcgttttgat
ccagtttttggtgttacaataggagcaaaagtatcaggtgttcactggttaataaacagt
cccaatatgccgcatgctgcagagtattgtacaggctattataattatagtactttgctt
gatcagtttaagaaatcaaatttagatttaacatttacatgtcttgaaaaggatgattca
aatccatataattatccttattcagcaccaaaaagtcttgttataaacattgcaaacttg
gctagagaaaaaggtataaaatattttggagagaacgcatcagatatttataataataaa
aaagcatatgaaaattgtgctgaaatgttatttaattataatttttcagggtttacactt
ttaagacttaaaaatatagttaattatgatggaacacctaccactgaaatggctcctttt
gcggatattttagccattaagccagttcctgtaacatttacagtaaataatgttaattta
gaaagcgatgagaatttatatttaactggaagtagatgggagatggctaattggagtacg
gaattttatccgttacaatttaaaaataataatggaagttatacaattaccacacatctc
gctgaaggtcataattacgaatttaaagcgataaagaagaataataatggaaatgtaata
tggcaaggtggttacaatcagttttataatgtttcaaaaggtggagattcttatacttgg
agttggtaa

DBGET integrated database retrieval system