KEGG   Clostridium botulinum Ba4: CLJ_B2586Help
Entry
CLJ_B2586         CDS       T00895                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbi  Clostridium botulinum Ba4
Brite
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLJ_B2586 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACQ55221
LinkDB All DBs
Position
complement(2551290..2551886)
Genome map
AA seq 198 aa AA seqDB search
MAHTLPNLNYDYNALEPHYDEQTLKIHHDIHHKTYVDGLNKAEQKLQEARESGDFTLIKH
WEREIAFHGSGHILHTLFWENMTPNGNLNPEGSAIERIKQDFGDYEKFKKQFTEAAIAVE
GSGWTILAWNPMFQKLVILQAEKHQNLTQWGVVPLLILDLWEHAYYLKYQNRRAEFINAW
WNIVNWDIVNTRYDNAIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcacatactttaccaaatttaaattatgattacaatgcattagaacctcattatgat
gagcagactttgaaaatacatcatgatattcatcataaaacttatgtagatggattaaat
aaagcggaacaaaagcttcaagaagctagagaatcaggagattttacattaataaagcat
tgggaaagggaaatagcatttcatgggtcaggtcatattttacatacattattttgggaa
aatatgacccctaatggaaatctaaatcctgagggatctgcaattgaaagaataaaacaa
gattttggggattatgaaaaatttaaaaaacaatttactgaagctgctatagcagtagaa
ggttcaggctggactattttagcatggaatcctatgtttcaaaaattagtaatattgcag
gcagaaaaacatcaaaatttaactcaatggggagtagttccactattaattctagattta
tgggaacatgcatattatttaaaatatcaaaatagaagggcagagtttattaatgcttgg
tggaatattgtaaattgggatatagtaaatactagatatgataatgctataaaataa

DBGET integrated database retrieval system