KEGG   Clostridium botulinum Ba4: CLJ_B3715Help
Entry
CLJ_B3715         CDS       T00895                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cbi  Clostridium botulinum Ba4
Brite
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLJ_B3715 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACQ52916
LinkDB All DBs
Position
complement(3740912..3741415)
Genome map
AA seq 167 aa AA seqDB search
MRKKYICKNAISYIKGGPLAPEIAGIVLFQDVPGGTVVYVNITGLPDYQPAKGEKGPIGP
HGFHIHEFGNCNVGLSEEPFKDAGEHWNPTNQPHGNHAGDFPVLFSNNGKSIMWFFTNKF
KVKDIIGKSIIIHENPDDYRSQPSGNAGRRLACGIINAYNWCMPYLW
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaatatatatgtaagaatgctatttcctacataaaaggtggacctctagcc
cctgaaattgcaggaattgtattatttcaagatgtacctggcggtactgtagtatatgta
aatattacaggtcttccagattaccaacctgcaaaaggagaaaaggggcctattggacca
catggatttcatattcatgaatttggaaattgtaatgtaggattatctgaagaaccattt
aaagacgcaggcgaacactggaatcctacaaatcagccacatggtaatcatgcaggagat
tttccagtattgttttcaaataatggaaaatctattatgtggttttttactaataaattc
aaggtcaaagatattattggaaaatctatcattattcatgagaatccggatgactacaga
tcccaaccatctggaaatgctggtagaagacttgcatgtggaataataaatgcttacaat
tggtgtatgccatatttatggtaa

DBGET integrated database retrieval system