KEGG   Clostridium botulinum H04402 065: H04402_01705Help
Entry
H04402_01705      CDS       T02076                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00010  Glycolysis / Gluconeogenesis
cbj00020  Citrate cycle (TCA cycle)
cbj00620  Pyruvate metabolism
cbj01100  Metabolic pathways
cbj01110  Biosynthesis of secondary metabolites
cbj01120  Microbial metabolism in diverse environments
cbj01130  Biosynthesis of antibiotics
cbj01200  Carbon metabolism
Module
cbj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H04402_01705
   00020 Citrate cycle (TCA cycle)
    H04402_01705
   00620 Pyruvate metabolism
    H04402_01705
Enzymes [BR:cbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     H04402_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBZ03515
LinkDB All DBs
Position
1827043..1828353
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKKEGDTIKVGETLFDVTTDKLTNNVEAKADGIVRKIL
VEEGTVVQCLKPVAIIGDKDEDISNLLKESLQDSKENEVEKEVKESKEEIKDNRKIKKGE
RAKISPIAKRLAKENDVDIQLLDGTGPEGRIVLKDVESYIENNKNNIKTSPVAEKMAKDL
GVNLEDIKKDGRIMKDDILEFIQKSTPSVGEDLMDRRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDMTNLKRLKEQIKDEWKVTYTDLLVKIVSKVLIQYPLVNCSIEGDEMIFRNYS
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNGLTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGVNMITNTPVVENGEIVIKPLMSLSLTADHRAVDGAVAAQF
LKAVKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagctagaggttatgccaaagctgggattaactatgacagagggtgaactagtt
aaatggcataaaaaagaaggagatactataaaggtaggagagaccttatttgatgtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaagatttta
gtagaggaaggtacagtagttcaatgtttgaaaccagtagccataattggagataaagat
gaggatatatcaaatctattaaaggaatctttacaagatagtaaggaaaatgaagtagaa
aaagaagttaaagaatctaaggaagagataaaagataataggaaaattaaaaaaggagaa
agagcaaagatatccccaatagcaaaaagacttgcaaaggaaaatgatgtggatattcaa
ctattagatggaacagggcctgaaggaagaatagttttaaaagatgtagaatcatatata
gaaaataataagaataatattaaaacttctccagtagcagagaagatggccaaagattta
ggcgttaatttagaagatataaagaaagacggaagaataatgaaagatgatatattagaa
tttatccaaaaatctactccttctgtaggagaagatttaatggatagaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgacattgaagtggacatgactaatttaaaaaggttaaaggaacaaattaaa
gatgaatggaaagttacttatacagatttattagtaaaaatagtttctaaagtactcatt
caatatcctttagttaattgctcaatagaaggagatgaaatgatttttagaaattattca
aatattggagtagcagtggctttagaggaaggccttgtggtaccagtggttaaatatgca
aaccaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagctaaa
aataatggacttactgaagaaaatagtactggaggaacttttactataactaatcttggt
atgtttggtataaagtctttttctccaattataaatcagcctgaagtagctatattaggt
gtgaatatgataactaatactccagtggtagagaatggagaaatagtgataaaacctctt
atgagcttatctcttactgcagaccatagggcggtagatggtgctgtagcggctcaattc
ttaaaagcagttaaaaaatatatggaaaagccagagttgcttatattgtag

DBGET integrated database retrieval system