KEGG   Clostridium botulinum H04402 065: H04402_01957Help
Entry
H04402_01957      CDS       T02076                                 

Definition
(GenBank) tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00030  Pentose phosphate pathway
cbj01100  Metabolic pathways
cbj01120  Microbial metabolism in diverse environments
cbj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H04402_01957
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     H04402_01957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N DUF2291 MTD
Motif
Other DBs
NCBI-ProteinID: CBZ03765
LinkDB All DBs
Position
complement(2077310..2079127)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEAEHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNEEEAKKISLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKIF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHNAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattgtctattgaaaataaacttgtt
atagttacaggccctattactggagctcctatgccaacaagtggtagatatatggtagta
acaaaggctcctttgactgggactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggttcctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcagagcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaacaatgaaagagcaaaagtacta
tgtataggacccgcaggagaaaagttatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttccggaaaagttaaagtagtcaatgaagaggaagcaaaaaaaatatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtggaggactacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcttatacagatgaggctgataaaataagtggagaaacccttacagaggattgc
cttgtaagaaaaaatccatgttatagatgtccaatagcctgcggtagatgggtaaaatta
gatgatggcacagaatgtggaggcccagagtatgaaactttatggtcctttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagctatggaattatacgaaaaagga
tatataaaagatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaaaaagatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctatggtgttccagagttttctatgacagttaaa
aagcaagaattaccagcctatgacccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcttatgctaaaatattc
cacgacttaacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagttacataatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttcccatgatacccttccaaaaagattgcttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatactatgca
gtaagaggatgggacaagaatggtataccaacagaggatacattaaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system