KEGG   Clostridium botulinum H04402 065: H04402_02380Help
Entry
H04402_02380      CDS       T02076                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbj  Clostridium botulinum H04402 065
Brite
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H04402_02380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBZ04188
LinkDB All DBs
Position
complement(2503691..2504287)
Genome map
AA seq 198 aa AA seqDB search
MAHTLPNLNYDYNALEPHYDEQTLKIHHDIHHKTYVDGLNKAEQKLQEARESGDFALIKH
WEKEIAFHGSGHILHTLFWENMTPNGKLNPEGSVIERIKQDFGDYEKFKKQFTEAAIAVE
GSGWTILAWNPMFQKLVILQAEKHQNLTQWGVVPLLILDLWEHAYYLKYQNRRAEFVNAW
WNIVNWDIVNTRYDNAIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcacatactttaccaaatttaaattatgattacaatgcattagaacctcattatgat
gagcagactttgaaaatacatcatgatattcatcataaaacttatgtagatggattgaat
aaagcggaacaaaagcttcaagaagctagagaatcaggagattttgcattaataaagcat
tgggaaaaggaaatagcttttcatggatccgggcatattttacatacattattttgggaa
aatatgactcctaatggaaagctaaaccctgagggatctgtaattgaaagaataaaacaa
gatttcggggattatgaaaaatttaaaaaacaatttactgaagctgctatagcagtagaa
ggttcaggttggactattttagcatggaatcctatgtttcaaaaattggtaatattgcag
gcagaaaaacatcaaaatttaactcaatggggagtggttccactattaattttagattta
tgggaacatgcatattatttaaaatatcaaaatagaagggcagagtttgttaatgcttgg
tggaatattgtaaattgggatatagtaaatactagatatgataatgctataaaataa

DBGET integrated database retrieval system