KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A0411Help
Entry
CLL_A0411         CDS       T00696                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00970  Aminoacyl-tRNA biosynthesis
cbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLL_A0411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cbk03029]
    CLL_A0411
Enzymes [BR:cbk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CLL_A0411
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CLL_A0411
Mitochondrial biogenesis [BR:cbk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CLL_A0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACD24243
UniProt: B2TIZ9
LinkDB All DBs
Position
422720..424177
Genome map
AA seq 485 aa AA seqDB search
MDFTNYKAHELKNLISKKEASVEEVTKAHLENVKNIDEKVNAFLYIAEEEALNDAKALDE
KLSKGEDIGLLGGAPLGIKDNISVKNMQNTCASKILEGYISPYDATVSESVKSQGGVILG
KLNMDEFAMGSSTENSAYKITRNPWDLDRVPGGSSGGSAAAVASKEVPLALGTDTGGSVR
QPASFCGIVGLKPTYGRVSRSGVVAYGSTLDQVGTLGRDVKDCALLTQVISGVDHRDFTT
ANINVPNYENSLSENIKGKKIALPKEFFKDGLDPKVQKAIYDALEVFKANGAEITEVSLP
LADYAISAYYLLACAEASSNLARFDGVRYGHRSESVEDAVDVYFKSRSEAFGKEVKKRIM
LGTYALSAGYYDAYYKKALKVRNLIKGEFENIFKDFDAIISPTAPTPAYKIGEKTENALE
MYLGDIYTVPVNIAGIPAISLPCGVADGLPVGLQIMGNYFKEDTLFNLAYSYEQSTKWHE
MHPNL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggattttacaaattataaagctcatgaattaaagaatttaatttctaaaaaagaagct
tcagtagaagaagttactaaagctcatttagaaaatgtaaagaatatagatgaaaaagta
aatgcatttttatatattgcagaagaagaagcgttaaatgatgctaaagcgttagatgaa
aagttaagtaaaggtgaagatattggattactagggggagcacctttaggaatcaaagat
aatataagtgttaagaacatgcaaaacacttgtgcatctaagatattagaaggatatata
tcaccatacgatgctacagtttctgaaagtgtaaagtcacaaggtggagttatattaggt
aaattaaatatggatgaatttgcaatgggttcatcaactgaaaattctgcttataagata
actagaaatccttgggatttggatagagtaccaggtggatcatcaggtggatctgctgct
gctgttgcttcaaaagaagttcctttagcattaggaactgacactggtggatcggtaaga
caaccagcatctttttgtggaatagttggattaaaacctacatatggaagagtttcaaga
agtggagttgtagcttatggttctactttagatcaagttggtacattaggaagagatgtt
aaagattgtgctttattaacacaagtaatatcaggtgttgatcacagagattttactaca
gctaatataaatgtacctaattatgaaaattctttatcagaaaatattaaaggaaagaaa
atagcattaccaaaggaatttttcaaagatggattagaccctaaagttcaaaaagctata
tatgacgcattagaagtattcaaagctaatggtgcagaaattacagaagtatcacttcca
ttagcagattatgctatatcagcttattatttattagcatgtgcagaagcatcatcaaat
ttagctagatttgatggagtaagatatggacatagaagtgaaagtgttgaagatgcagtt
gatgtatactttaaatcaagaagtgaagcatttggaaaagaagttaaaaagagaataatg
cttggtacttatgcattatcagcaggatattatgatgcatattataagaaagcattaaaa
gttagaaatcttataaaaggtgaatttgaaaatatatttaaagattttgatgcgataata
tcaccaacagcaccaactccagcttataaaattggagaaaaaacagaaaatgcattagaa
atgtatttaggagatatttatactgttcctgtaaatatagcaggtattccagcaatatca
cttccatgtggagttgctgatggtcttccagtaggacttcaaataatgggtaactatttt
aaagaagacacattatttaatcttgcatatagctatgaacaatcaactaaatggcatgaa
atgcatccaaatctatag

DBGET integrated database retrieval system