KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A1573Help
Entry
CLL_A1573         CDS       T00696                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00473  D-Alanine metabolism
cbk01100  Metabolic pathways
cbk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLL_A1573 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CLL_A1573 (alr)
Enzymes [BR:cbk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLL_A1573 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cbk01011]
 Precursor biosynthesis
  Racemase
   CLL_A1573 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C FCH
Motif
Other DBs
NCBI-ProteinID: ACD22809
UniProt: B2TKD2
LinkDB All DBs
Position
complement(1629442..1630602)
Genome map
AA seq 386 aa AA seqDB search
MEKIMRPVWAEIDLDAIAYNMRNIKKLAQNKDVIAVVKADCYGHGALDVVPTLLENGASR
LAVAVLTEAIELRNNNITAPIMILGYTPEYLFEEVVNYDIEQTVYDLEYAKKLSHLAIKF
NKKAKVHIAIDTGMGRIGFIPNEKAIKDIKKIYNLKGLDVIGIFTHFSTSDETDKEYTNE
QFNKFTSFIDMLSKVGVKIPIKHISNSGAIIDMPKTYLDSVRAGIILYGYYPSDEINKDN
IKLKPALTLKASLTRVQELDINSYISYGKTFKTERKSIIATLPIGYADGYSRLLAPGAKV
IINGKFSPIIGRICMDQCMIDVTDIDDIHVGDEVIILGEDGNLKLTANDLAKSMGTINYE
ILCMLKYRIPRVYMKNGKIFTVRNYL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataatgagaccagtatgggcagaaatagatttagatgcaatagcgtataat
atgagaaacataaagaaattagcgcaaaataaagatgtaattgcagttgtaaaggctgat
tgttatggacacggagctttagatgtagttcctacactacttgaaaatggtgcttctaga
cttgctgttgctgttttaactgaagcaattgagcttagaaacaacaatataactgctcca
attatgattttaggatacactcctgaatatttatttgaagaagtagtcaattatgatata
gaacaaactgtttatgatttagaatatgcaaaaaaattatcacatttagctataaaattt
aataaaaaagccaaagtccatattgctattgatacaggtatgggtagaattggatttatt
ccaaatgaaaaggcaattaaagatattaagaaaatatataatttgaaaggtctagatgta
attggtatatttactcacttctcaacttctgatgaaactgataaggaatatactaatgaa
caatttaataagtttacatcttttatagatatgctttcaaaggttggagttaaaattcca
ataaagcatatatctaatagtggtgctattatagatatgccaaaaacttatttagacagc
gtaagggctggtataatactatatggatattatccatctgatgaaataaataaagataat
attaagttaaaaccagctctaactctaaaagccagtttaacacgtgtacaagaattagat
ataaacagttatataagttatggtaaaacatttaaaactgaaagaaaaagcattatagca
actttacctattggatatgctgatggatattctagattgcttgctcctggtgctaaagtt
ataataaatggaaaattctctccaattattggtcgaatatgcatggatcaatgtatgatt
gatgttactgatattgatgatattcatgttggtgatgaagtaataattcttggagaagat
ggtaatttaaaattaactgctaatgatcttgctaaatctatgggaacaataaattatgaa
attctttgtatgcttaaatatagaatacctagagtttatatgaaaaatggtaaaatattt
actgttagaaattatctttaa

DBGET integrated database retrieval system