KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A2097Help
Entry
CLL_A2097         CDS       T00696                                 

Definition
(GenBank) glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Brite
KEGG Orthology (KO) [BR:cbk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbk02000]
    CLL_A2097
Transporters [BR:cbk02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    CLL_A2097
Ion channels [BR:cbk04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   CLL_A2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ACD24971
UniProt: B2TLK0
LinkDB All DBs
Position
complement(2193383..2194093)
Genome map
AA seq 236 aa AA seqDB search
MNMTTFFAEMFGTLILVLLGDAVVANVILKKTKGQNSGWMVISSGWAVAVAIPVYMFANI
SGAHFNPAVTIALATVGQFPWADVPMYITAQFIGAFIGATLVLISYYNHFEATEDQATKL
GVFCTAPEIRKPVFNFITEFVGTFILVFAIMGATAQPFVNGTQPVAIGVIILAMGLCLGG
PTGYAINPARDLAPRLVHFLLPVPNKGTSDWGYAWIPVVAPIAGAIAGALVYVNIF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgacaacattttttgcagaaatgtttggaactttaatcttagtattattagga
gatgctgttgtagctaacgtaatacttaagaaaacaaagggtcaaaattcaggatggatg
gttatatcaagtggatgggctgtagctgttgcaattccagtatatatgtttgcaaatatt
agtggagcacattttaaccctgcagttacaatagcattagctactgttggacaatttcca
tgggctgatgttcctatgtatataactgcacaatttataggagcatttataggagctact
ttagttcttatttcttactataatcattttgaagcaactgaagatcaagctacaaaatta
ggagttttttgtacagctccagaaataagaaaacctgtatttaactttataactgagttt
gtgggaacatttatattagtttttgcaataatgggagcaacagcacaaccatttgtaaat
ggaactcaaccagtagctataggtgtaataatattagcaatgggattatgtttaggtggt
ccaacaggatatgcgataaacccagctagagatttagcaccaagacttgttcacttttta
ttgccagtaccaaataaaggtacttcagattggggctatgcatggataccagtagtagca
ccaatagcaggagcaatagcaggagctttagtttacgtaaatatattctaa

DBGET integrated database retrieval system