KEGG   Clostridium botulinum A3 Loch Maree: CLK_1097Help
Entry
CLK_1097          CDS       T00670                                 

Gene name
acoC
Definition
(GenBank) TPP-dependent acetoin dehydrogenase complex, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00010  Glycolysis / Gluconeogenesis
cbl00020  Citrate cycle (TCA cycle)
cbl00620  Pyruvate metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01130  Biosynthesis of antibiotics
cbl01200  Carbon metabolism
Module
cbl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLK_1097 (acoC)
   00020 Citrate cycle (TCA cycle)
    CLK_1097 (acoC)
   00620 Pyruvate metabolism
    CLK_1097 (acoC)
Enzymes [BR:cbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLK_1097 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ACA55629
UniProt: B1L1Y1
LinkDB All DBs
Position
1872952..1874262
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKNEGDTIKAGETLFEVTTDKLTNNVEAKADGIVRRIL
VDEGTVVECLKPVAIIGDKDEDISNLLKESLQDSKENEVEKEVKESKGEIKDNRKIKKGE
RIKISPIAKRFAKENNVDIQLLEGTGPEGRIVLKDIEEYIENSKNNIKTSPVAGKIAKDL
GVNLEDLKKDGRIMKEDILGFIQESIPSVGEELMDKRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDITNLKRFKDQIKEEWKVTYTDLLVKIVSKALIQYPLVNCSIEGDEMIFRNYT
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNELTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGANMITNTPVVENEEIVIKPLMNLSLTADHRAVDGAVAAQF
LNSIKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttagaggttatgccaaagcttggattaactatgacagagggtgaattagtt
aaatggcataaaaatgaaggagatactataaaggcaggagagaccttatttgaggtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaggattcta
gtagatgaaggcacagtagttgaatgtttaaaaccagtagccataatcggagataaagat
gaggatatatcaaatctattaaaggaatctttacaagatagtaaggaaaatgaggtagaa
aaagaagttaaagaatctaagggagagataaaagataataggaaaattaaaaagggagaa
agaataaagatatctccaatagcaaaaagatttgcaaaggaaaataatgtggatattcaa
ctactagagggaacaggtcctgagggaagaatagtcttaaaagatatagaagaatatata
gaaaacagtaagaataatattaaaacttctccagtagcagggaagattgctaaagattta
ggcgttaatttagaggatttaaagaaagacggaagaataatgaaagaggatatattggga
tttatacaagaatctattccttctgtaggggaagagttaatggataaaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgatatagaagtggatataaccaacttaaaaagattcaaagatcaaattaag
gaggaatggaaagttacttatacagatttgttagtgaaaatagtttctaaagctctcatt
caatatcctttagttaattgttctatagaaggagatgaaatgattttcagaaattataca
aatattggagtagcggtggctttagaggaaggccttgtagtaccagttgttaagtatgct
aatcaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagcaaaa
aataatgaacttactgaagaaaatagcactggaggaacttttactataactaatcttggt
atgtttggtataaaatccttttcgccaattataaatcagcctgaagtagctatattaggt
gcaaatatgataactaatactccagtggtggaaaatgaagaaatagtaataaaacctctt
atgaatttatctcttactgcagaccatagagcggtagatggtgctgtagcggctcagttt
ttaaattcaattaaaaaatatatggaaaagccagagttacttatattataa

DBGET integrated database retrieval system