KEGG   Clostridium botulinum A3 Loch Maree: CLK_1372Help
Entry
CLK_1372          CDS       T00670                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00250  Alanine, aspartate and glutamate metabolism
cbl00410  beta-Alanine metabolism
cbl00430  Taurine and hypotaurine metabolism
cbl00650  Butanoate metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLK_1372
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLK_1372
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLK_1372
   00430 Taurine and hypotaurine metabolism
    CLK_1372
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLK_1372
Enzymes [BR:cbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CLK_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACA53668
UniProt: B1KTZ5
LinkDB All DBs
Position
2153761..2155164
Genome map
AA seq 467 aa AA seqDB search
MLYSSKNKQSNDTYATPIFGITKDKYSIPKYKINENSIAPNIAYRMIKDELMNEGNARLN
LATFCQTYMEDKATKLMAETLQKNAIDKSEYPQTAEIENRCVNIISDLWNVPKDMNFLGT
STVGSSEACMLGGMSMKFRWRDQAKKLGIDINKKKPNLVISSGYQVCWEKFCVYWDIEMR
TVPMDEDNLSLNIDKILDYVDEYTIGIIGILGITYTGKFDDIKALDDAIEKYNSNHDMKV
YIHVDAASGGFFTPFINPEILWDFRLKNVVSINASGHKYGLVYPGIGWILWKDQEYLPKD
LIFEVSYLGGKMPTLAINFSRSGSQIIGQYYNFLRFGFEGYKKIHERTKEVAMYISKELE
ATGLFSIYNDGSNLPIVCYKLKEQSNVKWNLYDLSDRLAMKGWQIPAYPLPENLNHIIIQ
RIVCRSDLGYNLAELLIKDFKTAINDLNNAHILFHEEENQGIYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctctattcttcaaaaaacaagcaaagtaatgatacctatgctacccctatttttggt
atcactaaggacaagtattcaattcctaagtacaaaattaatgaaaattctattgcacct
aatatagcctatcgtatgattaaagatgaacttatgaatgaaggtaacgcacgcttaaat
ttagctactttttgtcaaacctatatggaagataaagctacaaaacttatggctgaaacc
ttacaaaaaaatgctatcgacaagtctgaatatccacaaactgccgaaatagagaatcgc
tgtgttaatattatttcagatctttggaatgtcccaaaggatatgaacttcttaggtacc
tctactgtgggttcttcagaagcttgtatgctaggtggtatgtctatgaaattccgttgg
cgtgatcaggctaaaaaattaggtattgatattaataagaagaaacctaacttagtaata
tcatctggttatcaggtatgctgggaaaaattctgtgtatattgggatattgaaatgcgt
accgttcctatggatgaggataatctaagtttaaatatagataagattcttgattatgta
gatgaatatactataggaattataggtattttaggtataacttatacgggtaaatttgat
gatattaaagcattagatgatgccattgaaaaatataatagtaatcatgatatgaaggta
tatattcatgtagatgctgcctctggtggctttttcaccccatttattaatccagaaatt
ttgtgggattttcgtctaaaaaatgtagtttctataaatgcatccggtcataaatatgga
ttagtgtatccaggaataggttggattctgtggaaagatcaagaatatcttcctaaagat
ttaatatttgaagtaagttatttgggtggcaaaatgccaaccttagctattaatttttct
agatctggaagtcaaatcataggacaatattataatttcctacgctttggttttgaagga
tataaaaaaatccatgaacgcacaaaagaggtagctatgtatatttcaaaagagcttgaa
gctacagggttattcagtatatataatgatggcagtaatcttcctatagtttgttataag
ctaaaggaacaatctaatgtaaaatggaatctttatgatttatcagatagactagctatg
aaaggctggcaaataccagcttaccctctccctgaaaatcttaaccatataataatacaa
agaatagtttgtcgttcagatctaggatataatttagcagaactattgataaaagatttt
aaaacagcaataaatgatttgaataatgctcatatattatttcatgaagaagaaaaccaa
ggtatttatggatttactcattaa

DBGET integrated database retrieval system