KEGG   Clostridium botulinum A3 Loch Maree: CLK_1393Help
Entry
CLK_1393          CDS       T00670                                 

Gene name
aor
Definition
(GenBank) aldehyde ferredoxin oxidoreductase, tungsten-containing
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00030  Pentose phosphate pathway
cbl01100  Metabolic pathways
cbl01120  Microbial metabolism in diverse environments
cbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLK_1393 (aor)
Enzymes [BR:cbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLK_1393 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N DUF2291 MTD
Motif
Other DBs
NCBI-ProteinID: ACA54958
UniProt: B1KU16
LinkDB All DBs
Position
complement(2178681..2180498)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSDVPV
YVNIEDDKIEIKEANHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNEEEAKKVSLEKIKILREDPVAGEGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKVF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggcaagattttaaggattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctaggggacttggagttaag
actttattagaagaaatagaccctaaaatagatccattatctattgaaaataaacttgtt
atagttactggtcctattactggagctcctatgccaactagtggtagatatatggtagta
acaaaggctcctttaactggtactattgcaatatcaaattctggtgggaaatggggaaca
gaacttaaaaatgcaggatatgatatgataatagtacaaggtaaatcagatgtacctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcaaatcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaataatgaaagagcaaaagtattg
tgtataggacccgcaggagaaaaattatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtagttaaaggctctggaaaagttaaagtagttaatgaagaggaagcaaagaaagtatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtgaaggactacctacttat
ggctctgctgtgcttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcctatacagatgaggcagataaaataagtggagaaacccttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcttgtggtagatgggtaaaatta
gatgatggtacagaatgtggaggcccagaatatgaaactttatggtcttttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagccatggagttatatgaaaaagga
tatataaaggatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaagaaaatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctacggtgttccagaattttccatgacagttaaa
aagcaagaactaccggcctatgatccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccagaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaagtattc
catgatttgacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagttacatgatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagatagttctcatgatacccttccgaaaagattgcttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatattatgca
gtaagaggatgggacaagaatggtataccaacagaggatacattgaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system