KEGG   Clostridium botulinum F 230613: CBF_1637Help
Entry
CBF_1637          CDS       T01865                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00340  Histidine metabolism
cbm01100  Metabolic pathways
cbm01110  Biosynthesis of secondary metabolites
cbm01230  Biosynthesis of amino acids
Module
cbm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CBF_1637
Enzymes [BR:cbm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CBF_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADF99357
LinkDB All DBs
Position
1754513..1754821
Genome map
AA seq 102 aa AA seqDB search
MNKNNVIDSLFNIIEDRKDKPIEGSYTGYLFEKGLDKILKKVGEESSEVIIAAKNEDKEE
LIKEICDLTYHIMVLMAEKQIKLDGIEKELEKRREKICNKKK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaataatgttatagatagtttatttaatataatagaggacagaaaagataag
cccatagaaggttcttatactggatatttatttgaaaaaggattggataaaatattaaaa
aaagtcggagaagaaagttcagaggtaattatagctgctaaaaatgaagacaaagaggaa
ctgataaaagaaatatgtgatttaacctatcacataatggttttaatggcagaaaaacaa
ataaaattagatggtatagaaaaagaattagaaaaaagaagagaaaaaatatgcaataaa
aaaaaatga

DBGET integrated database retrieval system