KEGG   Clostridium botulinum F 230613: CBF_1964Help
Entry
CBF_1964          CDS       T01865                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00250  Alanine, aspartate and glutamate metabolism
cbm00410  beta-Alanine metabolism
cbm00430  Taurine and hypotaurine metabolism
cbm00650  Butanoate metabolism
cbm01100  Metabolic pathways
cbm01110  Biosynthesis of secondary metabolites
cbm01120  Microbial metabolism in diverse environments
cbm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CBF_1964
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBF_1964
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBF_1964
   00430 Taurine and hypotaurine metabolism
    CBF_1964
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CBF_1964
Enzymes [BR:cbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CBF_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ADF99652
LinkDB All DBs
Position
2094599..2096002
Genome map
AA seq 467 aa AA seqDB search
MLYSSKNKQSNDTYATPIFGITKDKYSIPKYKINENSIAPNIAYRMIKDELMNEGNARLN
LATFCQTYMEDKATKLMAETLQKNAIDKSEYPQTAEIENRCVNIISDLWNVPKDMNFLGT
STVGSSEACMLGGMSMKFRWRDQAKKLGIDINKKKPNLVISSGYQVCWEKFCVYWDIEMR
TVPMDEDNLSLNIDKILDYVDEYTIGIIGILGITYTGKFDDIKALDDAIEKYNSNHDIKV
YIHVDAASGGFFTPFINPEILWDFRLKNVVSINASGHKYGLVYPGIGWILWKDQEYLPKD
LIFEVSYLGGKMPTLAINFSRSGSQIIGQYYNFLRFGFEGYKKIHERTKEVAMYISKELQ
ATGLFSIYNDGSNLPIVCYRLKEQSKVKWNLYDLSDRLAMKGWQIPAYPLPENLNHIIIQ
RIVCRSDLGYNLAELLIKDFKTAINDLNNAHILFHEEENQGIYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctctattcttcaaaaaacaaacaaagtaatgatacctatgctacccctatttttggt
atcactaaggacaagtattcaattcctaagtacaaaattaatgaaaattctattgcacct
aatatagcctatcgtatgattaaagatgaacttatgaatgaaggtaacgcacgcttaaat
ttagctactttttgtcagacctatatggaagataaagctaccaaacttatggctgaaacc
ttacaaaaaaatgctatcgacaagtctgaatatccacaaactgccgaaatagagaatcgc
tgtgttaatattatttcagatctttggaatgtcccaaaggatatgaacttcttaggtacc
tctactgtgggttcttcagaagcttgtatgttaggtggcatgtctatgaaattccgttgg
cgtgatcaggctaaaaaattaggtattgatattaacaagaagaaacctaacttggtaata
tcatctggttatcaggtatgttgggaaaaattctgtgtatattgggatattgaaatgcgt
accgttcctatggatgaggataatctaagtttaaatatagataagattcttgattatgta
gatgaatatactataggaattataggtattttaggtataacttatacaggtaaatttgat
gatattaaagcattagatgatgccattgaaaaatataatagtaatcatgatataaaggta
tatattcatgtagatgctgcctctggtggctttttcaccccatttattaatccagaaatt
ttgtgggattttcgtctaaaaaatgtagtttctataaatgcatccggtcataaatatgga
ttagtgtatccaggaataggttggattctgtggaaggatcaagaatatcttcctaaagat
ttaatatttgaagtaagttatttgggtggcaaaatgccaaccttagctattaatttttct
agatctggaagtcaaatcataggacaatattataatttcctacgctttggttttgaagga
tataaaaaaattcatgaacgcacaaaagaggtagctatgtatatttcaaaagagcttcaa
gctacaggattattcagtatatataatgatggcagtaaccttcctatagtttgttataga
ctaaaggaacaatctaaggtaaaatggaatctttatgatttatcagatagactagctatg
aaaggctggcaaataccagcttaccctcttcctgaaaatcttaaccatataataatacaa
agaatagtttgtcgctcagacctaggatataatttagcagaactattgataaaagatttt
aaaacagcaataaatgatttgaataatgctcatatattatttcatgaagaagaaaaccaa
ggtatttatggatttactcattaa

DBGET integrated database retrieval system