KEGG   Clostridium botulinum F 230613: CBF_2909Help
Entry
CBF_2909          CDS       T01865                                 

Definition
(GenBank) putative membrane protein
  KO
K07090  uncharacterized protein
Organism
cbm  Clostridium botulinum F 230613
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CBF_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ADG00526
LinkDB All DBs
Position
3075641..3076393
Genome map
AA seq 250 aa AA seqDB search
MFTILLLCFAGFLAAIIDAIAGGGGLITIPAYLMAGVPPHMALGTNKLCATCSSLTSCFN
FAQSGKINLKLFKILAPFSLIGAVLGVNTVMGIDANCLNIIVLILLVIVALFSLFSKNVG
LKNNFHGLNKKNTLLGIFLSFSLGFYTGFFGPGTGAFMMIGLIGVFKFDFVGASGNSKSL
TTISNMASLILFAFHRQINYKLAIPVSLAMIIGAKLGTKIALNKGSKVIKPVFTAISILI
AIKVLYQTIA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgtttactattttacttctatgttttgcaggctttttagctgcaatcatagatgccata
gctggcggtggaggactaattactatacctgcttatttaatggcgggagttccgccccat
atggccttaggcacaaacaaactttgtgctacctgttcttcattaacaagttgttttaat
tttgctcaatctggaaagattaatttgaagttatttaaaatattagctcctttttcattg
ataggtgctgtattaggtgttaacactgtaatgggcattgatgctaattgtctaaacatt
atagttcttattttattagttatagtagccttattcagtttattttctaaaaatgtaggc
ttaaaaaataattttcatggactaaacaaaaaaaataccctactaggaatttttctatct
ttttctctaggtttttatacaggcttttttggacctggtacaggagcttttatgatgata
ggattaattggggtttttaagtttgattttgtaggggctagtggaaactcaaaatcatta
actactataagcaatatggcttctttaatattatttgcttttcatagacaaataaattat
aagctagccatccccgtatccttagcaatgataattggtgctaagcttgggacaaaaata
gctttaaataaaggttctaaagtgataaaaccagtttttaccgctatatccattttaata
gctataaaagtattataccaaaccattgcataa

DBGET integrated database retrieval system