KEGG   Clostridium botulinum BKT015925: CbC4_0415Help
Entry
CbC4_0415         CDS       T01475                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00473  D-Alanine metabolism
cbn01100  Metabolic pathways
cbn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CbC4_0415 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CbC4_0415 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbn01011]
    CbC4_0415 (alr)
Enzymes [BR:cbn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CbC4_0415 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cbn01011]
 Precursor biosynthesis
  Racemase
   CbC4_0415 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEB75095
LinkDB All DBs
Position
432683..433846
Genome map
AA seq 387 aa AA seqDB search
MFKHLRPVWAEINLDNLAFNVKEIKKISSSKEIIGIVKADAYGHGALDVAPTLIENGATG
LAVAVINEGVELRRGGIECPIMVLGFTAPTLIDTLLRHDIEQTVFSLEYAKQLSGVAEKM
HKKIKIHIAVDTGMGRIGFLPNKESVQDVKKISNLPNVEIKGIFTHFSTADESNKEYTYY
QLKKFNEFYDELKKENINIQTRHIANSAAIMELSETQFEGVRPGIILYGYYPSNQVDKSK
LKLKPVMELKTNIVHIKKISSGKYISYGRKFKTERESIIATLPVGYADGYTRLLFNKAKV
IINGQFAPIIGRICMDQCMVDITDIKGDIKIGDEVILMGQENGIKIDADDIASMLGTINY
EVVCMISKRVPRVYIKNEEVVKIRNYV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaagcatttaagaccagtttgggcagaaattaatttagataatcttgcttttaat
gtgaaagagataaaaaaaatatcaagtagtaaagaaataataggtatagtaaaagctgac
gcatatggacatggtgcattagatgtagcgccaacacttatagaaaatggagctacagga
cttgcggtagcagtaattaacgagggggtagaactaagaagaggtggtattgaatgtcct
ataatggttttaggatttactgcacctactttaattgataccttacttagacatgatatt
gagcagacggtattttcactagaatatgcaaaacagttatcaggggtagctgaaaaaatg
cataaaaaaatcaaaattcatatagcagttgatacaggtatgggaagaataggattttta
cccaataaagaaagtgtacaggatgtaaaaaaaataagtaacttacctaatgtagaaata
aaaggtatatttacacacttttccacggcggatgaatctaataaagaatacacatattat
caattaaagaaatttaatgagttctatgatgaactaaagaaagaaaatataaatatacaa
actaggcatatagcaaatagtgccgcaataatggaattatcagaaactcaatttgaaggg
gtaaggccaggaataattttatatggttactatccatcaaatcaagttgataaatctaaa
ctgaagttaaagccggtaatggagcttaaaactaatatagttcacataaaaaaaatatct
tctgggaaatatataagttatggaagaaagttcaaaacagaaagagaaagtataattgca
acattaccagtaggatatgcagatggatacactaggctattatttaataaagccaaagta
ataataaacggacaatttgctcctataataggtagaatatgtatggatcaatgtatggtt
gatattactgatataaaaggtgatattaaaataggagacgaagtaatattaatgggacaa
gaaaatggaattaaaattgatgcagatgatattgcgagtatgttaggtactataaattat
gaagtggtttgcatgattagtaaaagagttccgagggtgtacataaaaaatgaagaagtg
gttaagattaggaattatgtatag

DBGET integrated database retrieval system