KEGG   Clostridium botulinum BKT015925: CbC4_1723Help
Entry
CbC4_1723         CDS       T01475                                 

Definition
(GenBank) putative transcriptional regulator, MarR family
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_24 HTH_27 Penicillinase_R HTH_Crp_2 HxlR Fe_dep_repress HTH_37 Crp Replic_Relax
Motif
Other DBs
NCBI-ProteinID: AEB76399
LinkDB All DBs
Position
complement(1839997..1840422)
Genome map
AA seq 141 aa AA seqDB search
MKYVFEESVAYMLNKVVLKIKKELTSRFNKYDVTIEQWRLLTRLWKVDGISQTQLAIRCS
KDLPTVTRMLDKLEKKEVIERKEDPNDSRAYLVFLTEKGKGLEEKLDPIAYEIENKSIQN
VRKEDIEVVKKVLDIMITNLD
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgtttttgaagaatctgttgcatatatgcttaataaagtagtattaaaaata
aaaaaagagcttacaagtagatttaataaatatgatgttaccatagaacaatggagacta
ttaactcgtttatggaaagttgatggtatttctcaaacacaattagcaataagatgtagt
aaggatctgcctacagttactagaatgttagataagcttgaaaaaaaagaagttattgaa
cgaaaagaagatccaaatgattctagagcatatttagtttttttaactgaaaagggaaaa
gggttagaggaaaaattagaccctattgcatatgaaattgaaaataaatctatacaaaac
gtaagaaaagaagatatagaagtagtaaaaaaagtattagatatcatgattactaattta
gattag

DBGET integrated database retrieval system