KEGG   Clostridium botulinum BKT015925: CbC4_1980Help
Entry
CbC4_1980         CDS       T01475                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00061  Fatty acid biosynthesis
cbn00620  Pyruvate metabolism
cbn00640  Propanoate metabolism
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01120  Microbial metabolism in diverse environments
cbn01130  Biosynthesis of antibiotics
cbn01200  Carbon metabolism
cbn01212  Fatty acid metabolism
Module
cbn_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CbC4_1980
   00640 Propanoate metabolism
    CbC4_1980
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CbC4_1980
Enzymes [BR:cbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CbC4_1980
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CbC4_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ATPgrasp_Ter GARS_A ATP-grasp_5 TTL
Motif
Other DBs
NCBI-ProteinID: AEB76652
LinkDB All DBs
Position
complement(2123371..2124720)
Genome map
AA seq 449 aa AA seqDB search
MIKKVLIANRGEIAVRIIRACRELGIRTVAIYSDIDKDSMHVKFADETVCIGKASAKESY
LNIQNIIMAAKLKGVEAIHPGYGFLSENSDFARICNEYDIKFIGPSADTIDSLGNKSKAR
EIMINAGVPVIPGSNGAVQDEEDALKQAEMIGYPVMVKASAGGGGRGIRIANSNDELINV
FNMAKTEAKNAFGDDTMYIEKFIENPRHIEFQILGDNYGNVIHLGERECSIQRRHQKVIE
ESPSVIMDEETRKKMGEVAIRAAKAVNYKNAGTIEFLLDKNGKFYFMEMNTRIQVEHPIT
EMVTGIDLVKEQLKITSGYKIEFNQQDIKIKGHAIECRINAEDPSCQFRPSPGTIEFVHF
PGGSGLRVDSAIYNGCVISPIYDSMIAKLICYGNTRNDAITTMKRALSEFIIDGVKTNIE
FQFDILNNEKFNAGKFNTSFLDKEFNTNL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagtattaattgcaaatagaggtgagattgcagttagaattatacgtgca
tgtcgagaactcggaataagaacagtagcaatatattctgatatagataaagattcaatg
catgtaaaatttgcagatgaaactgtatgtattggaaaggcttcggctaaagaaagttat
ctaaatattcaaaatattataatggctgcaaaattaaaaggtgtagaagcaatacatcct
ggatatggatttttatctgaaaatagtgattttgcaaggatatgcaatgagtatgacata
aaatttattggaccatcagctgatacaatagatagtctaggaaataaatctaaagcaaga
gaaataatgataaatgcaggagtgccagtaataccaggatctaatggagctgtacaagat
gaagaagatgcattaaaacaagcagaaatgataggatatccagttatggttaaagcatca
gctggtggaggaggcagaggaattagaattgcaaattcaaatgatgaattaattaatgta
tttaatatggcaaaaacagaagctaaaaatgcatttggtgatgataccatgtatatagaa
aagtttatagaaaatccgagacatattgaatttcaaattttaggtgataattatggaaat
gttattcacttaggggaaagagaatgttctatacaaagaagacatcaaaaggtaatagag
gaatcaccatctgttatcatggatgaagaaactagaaagaaaatgggagaagtcgctata
agggcggctaaagctgtaaattataaaaatgcaggaacgatagaatttttactagataaa
aatggaaagttttattttatggaaatgaatacaagaattcaagtagaacatcctataaca
gaaatggtaacaggaatagatttagtaaaagaacagttaaaaataacatccggatataag
atagaatttaatcaacaagatattaaaattaaaggacatgcaattgagtgtcgtattaat
gcagaagatcctagttgtcaatttagaccatcacctggaacgatagaatttgttcatttt
cctggtggaagtggattaagagtagatagtgctatatataatggatgtgtaatttcacct
atatatgattcaatgatagcaaaattaatttgttatggaaatactagaaatgatgcaatt
acaacaatgaaaagagcattaagtgaatttataatagatggagttaaaactaacatagag
tttcagtttgatatattgaataatgaaaaatttaatgcaggaaaatttaatacttcattt
ttagataaagaatttaatactaatttataa

DBGET integrated database retrieval system