KEGG   Clostridium botulinum BKT015925: CbC4_2388Help
Entry
CbC4_2388         CDS       T01475                                 

Definition
(GenBank) Peptidylprolyl isomerase
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cbn03110]
    CbC4_2388
Enzymes [BR:cbn01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CbC4_2388
Chaperones and folding catalysts [BR:cbn03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    CbC4_2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase cobW
Motif
Other DBs
NCBI-ProteinID: AEB77053
LinkDB All DBs
Position
complement(2588782..2589300)
Genome map
AA seq 172 aa AA seqDB search
MNPIVTIKMQNGDVMKAELYPEIAPNTVNNFISLINKGFYDGVIFHRVIPGFMIQGGDPD
GTGMGGPGYSIKGEFTSNGFKNDLKHTKGVLSMARAMSPDSAGSQFFIMVADAPHLDKQY
ASFGKVIEGMEVADKIVNQKTDYSDRPYEDQVMEKVTVDTFGVEYPEPEEIE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaatagttactattaaaatgcaaaatggagatgtaatgaaagcagaattatat
cctgaaatagcaccaaatacagtaaataactttattagtcttataaataaagggttttat
gatggagtcatattccacagagtaatacctggttttatgattcaagggggagatccagat
ggaactggtatgggaggtcctggatactcaataaaaggagaatttacttctaatggattt
aaaaatgatttaaagcatactaaaggagtattatctatggcaagagctatgagccctgat
tctgccggaagtcaatttttcataatggtagcagatgctcctcatttagataaacaatat
gcttcatttggaaaagttatagaaggtatggaagttgcagataagatagttaaccaaaag
acagattatagtgatagaccttatgaagaccaagttatggaaaaggttactgttgatact
tttggagtagaatatcctgaaccagaagaaatagaataa

DBGET integrated database retrieval system