KEGG   Clostridium botulinum A ATCC 3502: CBO1630Help
Entry
CBO1630           CDS       T00533                                 

Gene name
acoA
Definition
(RefSeq) TPP-dependent acetoin dehydrogenase complex, E1 component subunit alpha
  KO
K21416  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
cbo  Clostridium botulinum A ATCC 3502
Brite
KEGG Orthology (KO) [BR:cbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBO1630 (acoA)
Enzymes [BR:cbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CBO1630 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transketolase_N TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 5185885
NCBI-ProteinID: YP_001254132
UniProt: A5I2A0
LinkDB All DBs
Position
1768164..1769147
Genome map
AA seq 327 aa AA seqDB search
MKKLNENSIVEMYKTMLKIRKFEQVAMNTFAEGKIPGFVHLYIGEEAVATGVCANLKDSD
YITSTHRGHGHILAKGGDLKFMMAELFGKATGYCKGKGGSMHIADATKGILGANGIVGAG
HNIAVGAGLSAQYRGTDQVCVCFFGDASTNQGTFHESLNMASVWKLPVVFVCENNLYGIS
MSQNRHQAIKDVADRGVAYNVPGIVVDGNDVFAVYEAAKEAIKRAREGKGPTLIECKTYR
HRGHFEGDPCVYKPTEEQEEWLAKDPIPRFEKYLVENEILTEEKLKEVQNKVESQIDEAV
DFANNSPYPELESVLEDVYTDIKEEVR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaattaaatgaaaattctattgttgaaatgtataaaactatgctaaaaataaga
aagtttgagcaagtggcaatgaatacctttgcagaagggaaaattcctggctttgttcat
ctttatataggagaagaagcggtggctacaggagtgtgtgctaatttaaaggatagtgat
tatataacaagtactcacaggggtcatggacatatacttgcaaagggtggagatttgaaa
tttatgatggcagagctttttggaaaggctacaggatattgcaaaggaaaaggaggttct
atgcatattgcagatgcaactaaaggtattttaggggcaaatggtatagtaggtgccggt
cataatattgcagtgggagctggattaagtgcacaatacagaggaactgatcaagtgtgt
gtatgcttctttggagatgcgtcaactaaccaaggtacatttcatgaatctttaaatatg
gcaagtgtatggaaattaccagtggtttttgtatgcgaaaataacctttatggaatatct
atgagtcaaaatagacatcaagcaataaaggatgttgcagatagaggtgttgcttataat
gtaccaggtattgtagtagatggtaatgatgtatttgctgtgtatgaagcagctaaagaa
gctattaaaagagcaagagaaggcaagggaccaacacttatagaatgcaaaacttatcga
catagaggacattttgaaggagatccttgtgtttacaaaccaacagaggaacaggaagaa
tggctagctaaagatcctataccaagatttgaaaaatatttagtagaaaatgaaattttg
acagaagaaaagcttaaagaagttcaaaataaggtagagagtcaaattgatgaagcagta
gattttgcaaataatagtccatatccagaattagagtcagtattagaagatgtttatact
gacattaaagaggaggttagataa

DBGET integrated database retrieval system