KEGG   Clostridium botulinum A ATCC 3502: CBO1917Help
Entry
CBO1917           CDS       T00533                                 

Gene name
gadA
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00250  Alanine, aspartate and glutamate metabolism
cbo00410  beta-Alanine metabolism
cbo00430  Taurine and hypotaurine metabolism
cbo00650  Butanoate metabolism
cbo01100  Metabolic pathways
cbo01110  Biosynthesis of secondary metabolites
cbo01120  Microbial metabolism in diverse environments
cbo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CBO1917 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBO1917 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBO1917 (gadA)
   00430 Taurine and hypotaurine metabolism
    CBO1917 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CBO1917 (gadA)
Enzymes [BR:cbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CBO1917 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 5186172
NCBI-ProteinID: YP_001254419
UniProt: A5I341
LinkDB All DBs
Position
2036980..2038383
Genome map
AA seq 467 aa AA seqDB search
MLYSSKNKQSNDTYATPIFGITKDKYSIPKYKINENSIAPNIAYRMIKDELMNEGNARLN
LATFCQTYMEDKATKLMAETLQKNAIDKSEYPQTAEIENRCVNIISDLWNVPKDMNFLGT
STVGSSEACMLGGMSMKFRWRDQAKKLGIDINKKKPNLVISSGYQVCWEKFCVYWDIEMR
TVPMDEDNLSLNIDKILDYVDEYTIGIIGILGITYTGKFDDIKALDDAIEKYNSNHDIKV
YIHVDAASGGFFTPFINPEILWDFRLKNVVSINASGHKYGLVYPGIGWILWKDQEYLPKD
LIFEVSYLGGKMPTLAINFSRSGSQIIGQYYNFLRFGFEGYKKIHERTKEVAMYISKELE
ATGLFSIYNDGSNLPIVCYKLKEQSKVKWNLYDLSDRLAMKGWQIPAYPLPENLNHIIIQ
RIVCRSDLGYNLAELLIKDFKTAINDLNNAHILFHEEENQGIYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctctattcttcaaaaaacaagcaaagtaatgatacctatgctacccctatttttggt
atcactaaggacaagtattcaattcctaagtacaaaattaatgaaaattctattgcacct
aatatagcctatcgtatgattaaagatgaacttatgaatgaaggtaacgcacgcttaaat
ttagctactttttgtcagacctatatggaagataaagctaccaaacttatggctgaaacc
ttacaaaaaaatgctatcgacaagtctgaatatccacaaactgccgaaatagagaatcgc
tgtgttaatattatttcagatctttggaatgtcccaaaggatatgaacttcttaggtacc
tctactgtgggttcttcagaagcttgtatgttaggtggcatgtctatgaaattccgttgg
cgtgatcaggctaaaaaattaggtattgatattaacaagaagaaacctaacttggtaata
tcatctggttatcaggtatgttgggaaaaattctgtgtatattgggatattgaaatgcgt
accgttcctatggatgaggataatctaagtttaaatatagataagattcttgattatgta
gatgaatatactataggaattataggtattttaggtataacttatacgggtaaatttgat
gatattaaagcattagatgatgccattgaaaaatataatagtaatcatgatataaaggta
tatattcatgtagatgctgcctctggtggctttttcaccccatttattaatccagaaatt
ttgtgggattttcgtctaaaaaatgtagtttctataaatgcatccggtcataaatatgga
ttagtgtatccaggaataggttggattctgtggaaggatcaagaatatcttcctaaagat
ttaatatttgaagtaagttatttgggtggcaaaatgccaaccttagctattaatttttct
agatctggaagtcaaatcataggacaatattataatttcctacgctttggttttgaagga
tataaaaaaattcatgaacgcacaaaagaggtagctatgtatatttcaaaagagcttgaa
gctacaggattattcagtatatataatgatggcagtaatcttcctatagtttgttataaa
ctaaaggaacaatctaaggtaaaatggaatctttatgatttatcagatagactagctatg
aaaggctggcaaataccagcttaccctctccctgaaaatcttaaccatataataatacaa
agaatagtttgtcgttcagacctaggatataatttagcagaactattgataaaagatttt
aaaacagcaataaatgatttgaataatgctcatatattatttcatgaagaagaaaaccaa
ggtatttatggatttactcattaa

DBGET integrated database retrieval system