KEGG   Clostridium botulinum A ATCC 3502: CBO2217Help
Entry
CBO2217           CDS       T00533                                 

Definition
(RefSeq) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CBO2217
Enzymes [BR:cbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CBO2217
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CBO2217
    1.1.1.-  
     CBO2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA 2-Hacid_dh_C Pyr_redox ADH_zinc_N_2 ADH_N_assoc Shikimate_DH Pyr_redox_3 GP68 NAD_binding_7 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 5186472
NCBI-ProteinID: YP_001254711
UniProt: A5I3Y8
LinkDB All DBs
Position
complement(2374038..2375111)
Genome map
AA seq 357 aa AA seqDB search
MKAALWYEKKDVRVEEIEEPKVVEGSVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHALS
GTTAPVVLGHEFSGEIVELGQGVTKFNIGDRVIVEPIVACGKCPACMEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFVHKIPDEMSYEDAALVEPMAVALHSARIANFNTGDTALVLG
AGPIGLATIECLKAAGARLIVVLQRKSIRQKYAKRAGADVVLDPNEVNIPEEVKKLTDGL
GVDVAFETTGAKIGFDTGIESLKFEGTMVITSIWEKDTSFNPNVLVFTEKKIVGTLAYRH
EFPATMALMKDGRIKTDGYITKKIALDDIVEEGFGALTGPEKKKHVKIIVTPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgaaaaaaaagatgtaagagtggaagaaattgaagaacca
aaggtagtagaaggatctgtaaaaattaaagtaaaatggtgtggaatatgtggttccgat
ttacatgaatatttaggaggccctatatttattccagtaggacaacctcatgcgttaagt
ggaacaacagcaccagtagttttaggacacgaattttcaggagaaatagtagaattagga
caaggtgtaacaaaatttaatattggagatagggtaattgttgaacctatagtagcttgt
ggaaaatgtccagcctgtatggaagggaaatataatctttgttcatctttaggttttcat
ggactttgtggaagtggcggtggacttgcagaatatactgtatttccagaggaatttgtt
cataaaattccagatgaaatgtcctatgaggatgcggctttagtagaaccaatggcagta
gcacttcattctgcaagaatagctaattttaatacaggagatacagctttagtattaggt
gcaggaccaataggtcttgctacaatagaatgcttaaaagcagctggagcaagactcata
gtagttttacaaagaaaatctataagacaaaaatatgcaaaaagagcaggggcagatgta
gttttagatcctaatgaagttaatataccagaagaagttaaaaaacttacagatgggtta
ggtgtagatgtagcctttgaaaccacaggagctaagataggatttgatactggtattgaa
agcttaaaatttgaaggtacaatggttataactagtatatgggaaaaggatacaagcttt
aatccgaatgtattagtatttactgaaaagaaaattgtaggaactttagcatatagacat
gaattcccagccactatggcgttaatgaaggatggaagaataaaaacagatggatatatt
acaaagaaaatagctttagatgatatagtagaagaaggatttggggctttaactggaccg
gaaaagaaaaaacatgtaaaaattattgtaactccagataaatcacttttataa

DBGET integrated database retrieval system