KEGG   Clostridium botulinum A ATCC 3502: CBO2277Help
Entry
CBO2277           CDS       T00533                                 

Definition
(RefSeq) Mn/Fe superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbo  Clostridium botulinum A ATCC 3502
Brite
Enzymes [BR:cbo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CBO2277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 5187439
NCBI-ProteinID: YP_001254769
UniProt: A5I446
LinkDB All DBs
Position
complement(2432526..2433122)
Genome map
AA seq 198 aa AA seqDB search
MAHTLPNLNYDYNALEPHYDEQTLKIHHDIHHKAYVDGLNKAEQKLQEARESGDFALIKH
WEKEIAFHGSGHILHTLFWENMAPNGNLNPEGSAIERIKQDFGDYEKFKKQFTEAAIAVE
GSGWTILAWNPMFQKLVILQVEKHQNLTQWGVVPLLILDLWEHAYYLKYQNRRAEFINAW
WNIVNWDIVNTRYDNAIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcacatactttaccaaatttaaattatgattacaatgcattagaacctcattatgat
gagcagactttgaaaatacatcatgatattcatcataaagcttatgtagatggattgaat
aaagcggaacaaaagcttcaagaagctagagaatcaggagattttgcattaataaagcat
tgggaaaaggaaatagcatttcatgggtcaggtcacattttacatacattattttgggaa
aatatggcccctaatggaaatctaaatcctgagggatctgcaattgaaagaataaaacaa
gattttggagattatgaaaaatttaaaaaacaatttacagaagctgctatagcagtagaa
ggttcaggctggactattttagcatggaatcctatgtttcaaaaattagtaatattgcag
gtagaaaaacatcaaaatttaactcaatggggagtagttccactattaattttagattta
tgggaacatgcatattatttaaaatatcaaaatagaagggcagagtttattaatgcttgg
tggaatattgtaaattgggatatagtaaatactagatatgataatgctataaaataa

DBGET integrated database retrieval system