KEGG   Clostridium botulinum A ATCC 3502: CBO3397Help
Entry
CBO3397           CDS       T00533                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00473  D-Alanine metabolism
cbo01100  Metabolic pathways
cbo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBO3397 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CBO3397 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbo01011]
    CBO3397 (alr)
Enzymes [BR:cbo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CBO3397 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cbo01011]
 Precursor biosynthesis
  Racemase
   CBO3397 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C MazG_C
Motif
Other DBs
NCBI-GeneID: 5186557
NCBI-ProteinID: YP_001255879
UniProt: A5I7C2
LinkDB All DBs
Position
complement(3637773..3638933)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDLDNLQHNLKQIKKICGNKEIIGVIKANAYGHGAMEIAPTLLENGVSR
LAVAVLSEAMELRMSGVKEPIMILGYTPWALGDMLLDNDIEQSVYSYNDALELSKIAVLK
RKILKIHIVVDTGMGRIGFLPTKESVEDVYKISKLPNIEIEGIFSHFSSADESDKDYTLY
QMNKYNAFINKLEEKNIQVPIKHIANSAAIIDLENTHLDAVRAGIIMYGYYPSNYVLRNN
INLKPVMSLKTSIVHIKKVSSGEYISYGRTFKTKRESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTFIENLKVGDVVTIMGEENGVSYTAEDIASQIGTISYE
VICNVNKRVPRVYKKDGKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaatcgatctagataatttacaacataac
ttaaaacaaataaaaaaaatatgtggaaataaagagataataggggttataaaggctaat
gcatatggacatggagccatggaaatagcccctactcttttagaaaatggagtaagtaga
ttagcagtggcggttttaagtgaggctatggagcttagaatgagtggagtaaaggagccc
attatgatattaggttatacaccatgggctttaggagatatgcttttagataatgatata
gaacaatctgtatactcttataatgatgctttagaattatctaaaatagcggtgctaaaa
agaaaaatattaaaaatacatatagtggtagatactggcatggggagaattgggttttta
cctacaaaagaaagtgtagaagatgtatataaaataagtaagttgcctaatattgaaata
gaagggatattttctcatttttcttctgctgacgagtcagacaaagattatactttgtat
caaatgaataagtacaatgcatttataaacaaattagaggagaaaaatattcaagtacct
ataaagcatattgctaatagcgcagctataattgatttagaaaatactcatttagatgca
gtaagagcgggtattataatgtatggatactatccgtccaattatgtactaagaaataat
ataaatctgaaaccagtaatgtctttaaaaaccagtatagtacacataaaaaaagtatct
tcgggagaatatataagttatggcagaactttcaaaacaaagagagaaagcataatagct
accttacctataggttatgcagatggatataatagattattaagcaataaaggaaaagtt
atagttaacggcaaacttgctccagtaataggaagagtttgtatggatcaatgtatgata
gatgtaacttttatagaaaatttaaaagtcggagatgtggttacaattatgggggaggaa
aatggagtaagctatactgcagaggatatagcatcacaaataggcactataagttatgaa
gttatatgtaatgtaaataagagggtaccaagagtatataagaaggatggcaaaattata
aatgtagtaaactacatataa

DBGET integrated database retrieval system