KEGG   Clostridium bolteae: CGC65_03890Help
Entry
CGC65_03890       CDS       T05466                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cbol  Clostridium bolteae
Pathway
cbol00473  D-Alanine metabolism
cbol00550  Peptidoglycan biosynthesis
cbol01100  Metabolic pathways
cbol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGC65_03890
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGC65_03890
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CGC65_03890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbol01011]
    CGC65_03890
Enzymes [BR:cbol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CGC65_03890
Peptidoglycan biosynthesis and degradation proteins [BR:cbol01011]
 Precursor biosynthesis
  Amino acid ligase
   CGC65_03890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ASN93882
UniProt: A0A412ZEC6
LinkDB All DBs
Position
811755..812816
Genome map
AA seq 353 aa AA seqDB search
MGKLQAAVIFGGQSSEHIVSCMSAVNVIEHIDRTRYDVLLVGITEDGHWIKADSLEDVKN
GTWRDKTVSALLLPDATKKCILLMDGDSVREVRVDVVFPVLHGLYGEDGTIQGLLELAKI
PYVGCGVLSSAVSMDKLYTKIIVDDLGVRQAAYEAVYREQLVHMESVVERVEKHFSYPVF
IKPSNAGSSRGVTKADDRQALEAGLSEAARHDRKILVEETIIGREIECAVFGGGLKEVVA
SGVGEILAAAEFYDFEAKYYNEESRTVTDPELPAGAAERVRQAAMDIFRAVDGYGLARVD
FFVKDDGEVVFNEINTMPGFTAISMYPMLWEARGITKDQLVDMLMAHGMERYT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacttcaggctgcagtcatatttggcggccagtcatcagaacatattgtgtcc
tgcatgtcggctgtcaatgtcattgagcatatagacaggacgcgatacgatgtattactt
gtaggaattacagaagatggacactggattaaggcagattcactggaagatgtaaaaaac
ggtacatggagggacaaaactgtatcagcccttctgctgccggacgccacgaagaagtgc
atcctccttatggacggagattcggtccgcgaggtcagggtggatgtggtattccctgtg
cttcacggtttgtacggggaggacggtaccatccaggggcttttggaactggctaagatt
ccctatgtgggatgcggggttctttcttccgcagtgtccatggataaactgtacaccaag
attatcgtggatgacctgggagtccgccaggcagcatacgaggcagtgtacagggaacag
cttgtgcatatggaatcggtggtggaacgggtggagaagcatttttcctatcccgtattt
attaagccgtccaatgcaggctcctccaggggcgtgacaaaggcggatgaccgccaggcc
ctggaagcaggactgtcagaggcagcccgtcatgaccgcaagatattggtagaggaaacc
atcataggcagagagattgagtgcgctgtattcggaggcggacttaaggaggtggtggca
tccggggtaggagagatactggccgctgcagagttttatgactttgaagccaagtattat
aacgaagaatccaggacagtgacggatccggagctgccggcaggggcggcagagagagtc
cggcaggccgccatggacatattccgtgcagtggacggctatgggctggccagagtggat
ttctttgtaaaggatgacggagaagtggtattcaatgagattaataccatgccaggtttt
accgccatcagtatgtatcccatgctgtgggaagccagagggatcacaaaggaccagctg
gtggatatgctgatggcccatgggatggaacgatacacttaa

DBGET integrated database retrieval system