KEGG   Clostridium bolteae: CGC65_06870Help
Entry
CGC65_06870       CDS       T05466                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
cbol  Clostridium bolteae
Pathway
cbol00030  Pentose phosphate pathway
cbol01100  Metabolic pathways
cbol01110  Biosynthesis of secondary metabolites
cbol01120  Microbial metabolism in diverse environments
cbol01130  Biosynthesis of antibiotics
cbol01200  Carbon metabolism
cbol01230  Biosynthesis of amino acids
Module
cbol_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cbol_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cbol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CGC65_06870
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CGC65_06870
Enzymes [BR:cbol01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CGC65_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Motif
Other DBs
NCBI-ProteinID: ASN94431
UniProt: A0A414AL94
LinkDB All DBs
Position
1467495..1468433
Genome map
AA seq 312 aa AA seqDB search
MNKIPNRKAICDTLMEAAKEDKDIVVLCSDSRGSASLTPFADACPDQFVEMGIAEQNLVS
VSAGLAKCGKKPFAASPACFLSTRSYEQIKVDAAYSNTNVKLIGISGGVSYGALGMSHHS
AQDIAALSAIPNMRVYLPSDRFQTACLVKELLKDDKPAYIRVGRNAVEDIYEEGNVPFSM
DKATVLSRGGDVAIIACGEMVKPALDAGRLLGESGISAGVVDMYCVKPLDEEAVQKAAGA
ARLVVTVEEHAPFGGLGSRVSQVVSACCPRMVVNLSLPDEPVITGTSAEVFEYYGLTGQG
IARRVQELLRQL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatacccaacaggaaggccatctgtgacacgctgatggaggctgcaaaggag
gataaagatattgtggtgctgtgcagtgattccaggggttccgcatccctgactcctttt
gcggatgcctgcccggaccagtttgtggaaatgggcattgctgaacaaaatctggtcagc
gtgtcggcaggactggcaaaatgcggtaaaaaaccctttgcggcttccccggcctgcttt
ctcagcaccagaagctatgaacagattaaggtggatgcagcgtattccaataccaatgta
aaactcatcggcatcagcgggggcgtcagctacggagcgctgggcatgagccaccattcg
gcccaggacatagcggccctgtccgccatacctaatatgagggtttatcttccaagcgac
cgtttccagacagcctgcctggtgaaggagctgttaaaggacgataagcctgcctatatc
cgtgtgggcaggaacgcggtggaggatatctatgaggagggaaatgtacccttttccatg
gataaggccacggtcctttcccggggaggggatgtggcaatcattgcctgcggggagatg
gtaaagcctgcgctggatgcagggcgtctgcttggggaatcaggaatcagcgcaggtgtg
gtggatatgtactgtgtgaagcctctggatgaggaggcggtccaaaaggcagccggagca
gccaggctggtggtgactgtggaggaacacgcgccctttggcgggctgggctccagggtg
agccaggtggtatctgcctgttgtccaaggatggtggtgaacttaagccttccggatgaa
cctgtcattacgggcacatcggcagaggtgtttgaatactacggcctgaccgggcaggga
attgcccgaagggtacaggaacttctgaggcagctctaa

DBGET integrated database retrieval system