KEGG   Clostridium bolteae: CGC65_08400Help
Entry
CGC65_08400       CDS       T05466                                 

Definition
(GenBank) superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cbol  Clostridium bolteae
Brite
Enzymes [BR:cbol01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CGC65_08400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASN98757
LinkDB All DBs
Position
complement(1776421..1776930)
Genome map
AA seq 169 aa AA seqDB search
MANQSVTPADIFADLLRFRAPAAIAWVRGGDAAPNLSGLVKFYQTPYSGVLVEAEIFNLP
NKQEPGSTDFYAMHIHQNGDCSDDFTKTGDHYNPSGEPHPDHAGDLLPLLGNEGYAWLSF
YDKRFSTDDIIGRSIVIHSHADDFTSQPSGNSGTKIGCGVIEKADYLKV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccaatccgtcactcctgctgacatctttgctgatttgctgcgctttcgggcc
cctgccgccattgcctgggtcagaggcggggatgccgcgcctaacttaagcggcctggta
aaattctaccagactccttacagtggtgtgctggtggaagccgaaatcttcaatctgccc
aacaaacaggaacccggctccacagacttttatgccatgcacatccaccagaacggtgat
tgctctgatgacttcaccaaaacaggggaccactacaatccgtccggcgaacctcatccg
gaccacgcaggcgacctgcttccccttcttggaaacgaaggttatgcctggctttccttc
tatgacaagcgcttctccacagatgacattatcggcaggtccatcgtcattcacagtcat
gccgacgactttacatcccagccctccggaaactccgggaccaaaatcggatgtggtgtc
attgaaaaagcggattatctaaaagtatag

DBGET integrated database retrieval system