KEGG   Clostridium bolteae: CGC65_15830Help
Entry
CGC65_15830       CDS       T05466                                 

Definition
(GenBank) DNA topoisomerase 4 subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
cbol  Clostridium bolteae
Brite
KEGG Orthology (KO) [BR:cbol00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cbol03032]
    CGC65_15830
   03400 DNA repair and recombination proteins [BR:cbol03400]
    CGC65_15830
Enzymes [BR:cbol01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     CGC65_15830
DNA replication proteins [BR:cbol03032]
 Prokaryotic type
  DNA Topoisomerases
   CGC65_15830
DNA repair and recombination proteins [BR:cbol03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      CGC65_15830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C DUF2118
Motif
Other DBs
NCBI-ProteinID: ASN95963
LinkDB All DBs
Position
complement(3366362..3368596)
Genome map
AA seq 744 aa AA seqDB search
MAEKILRTEYSEEMQRSYMNYSMSVITARAIPDARDGLKPVQRRVLYDMRELHLDHDKPH
RKSARIVGDTMGKYHPHGDSSIYETLVVMSQNFKKGMALVDGHGNFGSIEGDGAAAMRYT
EARLEKFAEEVYLKDLDKTVNFVPNYDETEKEPEVLPVRVPNLLINGAEGIAVGMSTSIP
PHNLGEVIDAVQAYIDNPEVTTQELMEFMPGPDFPTGGVIANKSELPQIYETGMGKIKLR
GKFEVELGKRKADKDKLIISEIPYTMIGAGINKFLVDVADLVESKKLTDVVDISNQSNKE
GIRIVLELRKDADIDKIKNILYKKTKLEDTFGVNMLAIADGRPETLNLKGILRNFLNFQY
ENTERKYNVLLQKEMDKKEVQEGLIAACDCIDLIIAILRGSKNLKDAKACLTTGDVTNIH
FKVPGFEEDAKKLAFTERQASAILEMRLYKLIGLEILALEKEHRETLRKIGEYKKILGSR
AQMNRVIKEDLAAIKAEFATPRRTLIEDGPEAVYDESAVAVQEMVFVMDRFGYCKLLDKS
TYDRNQETVDTEQVHVVKCLNTDKICLFAASGSLYQIKAMDVPAGKLRDKGTPIENLSKF
DGAKDTIVYLTSAEDMKGRIFVFATKMAMVKQVPSEEFETNNRVVAATKLQEGDELAAVI
PVEGETEVVIQTTGGVFLRFALEEISMLKKASRGVRGIRLTKNEELEKLYLIGENPIVDY
KGKEVHLNRLKLAKRDGKGSKVRL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagatattacggactgaatacagtgaggaaatgcagagaagctacatgaac
tattccatgagcgtcatcactgcaagggccatccctgatgccagggacggcttaaaaccg
gtacagcgccgggttctctatgatatgagggagctccatctggaccacgataagccccac
aggaaatcggcgcgtatcgtgggcgataccatgggtaagtaccatccccacggcgacagc
tccatatatgagacactggttgtcatgagccagaatttcaagaagggcatggccctggtg
gacggacacggcaacttcggctccatagaaggggacggggcagccgccatgcgttacacg
gaggcgcgtctggagaagtttgcggaggaggtctaccttaaagatctggataaaaccgtg
aattttgtgcccaactacgacgagacggaaaaggaaccggaggtgcttcctgtcagggtc
cccaacctgttaatcaacggggcggagggcattgccgtgggcatgagcacaagcattccg
ccccacaacctgggcgaggtgatagacgcggtccaggcgtacattgataatccggaggtg
accactcaggagctgatggagtttatgccggggccggatttccccaccggaggagtcatt
gccaataagagcgagctgccccaaatttacgagaccggcatgggtaaaatcaagctcagg
ggcaagttcgaggtggagcttggaaagcgcaaggcggacaaggataagctgattatttca
gagattccctataccatgattggcgccggaatcaataagtttctggtggatgtggccgat
ctggtggagagcaagaagctgacggacgtggtggatatctccaaccagtccaacaaagag
ggaatccgcatcgtgctggagctgcgcaaggatgcggacattgacaagataaaaaatatc
ctctataaaaagacaaagctggaggataccttcggggtcaatatgctggccattgcggac
ggccgtcctgagacgctgaacctgaaggggatcctgagaaatttcctcaacttccagtat
gagaacacggagcgcaaatacaatgttttactccagaaggaaatggataaaaaggaagta
caggaaggacttattgcggcctgcgactgtattgacctgatcatagccatcctgaggggc
tccaaaaacttaaaggatgccaaggcatgtctgaccacaggcgatgtgaccaacatccat
ttcaaggttccggggtttgaggaggacgcaaagaagcttgcctttacggagcgccaggca
tccgctattctggaaatgcgtctttataagttaatcggactggaaatcctggctctggaa
aaggagcacagggagaccttaaggaagattggggagtataagaaaatcctgggaagcagg
gcccagatgaaccgtgttatcaaggaggatctggctgccatcaaggctgagtttgccact
cccaggcgcaccctgattgaggacggacctgaggcggtgtacgacgagagcgctgtggct
gtccaggagatggtctttgtgatggaccggttcggatactgcaagctgttggataagtcc
acctatgaccggaaccaggaaaccgtggacaccgagcaggtccacgtggtgaaatgtctg
aatacggataaaatctgtctctttgctgccagcggcagcctttaccagataaaggccatg
gatgtgccggccggcaagctgagggataagggaacgcccattgagaatctgagtaaattc
gacggtgccaaggatactattgtttacctgaccagcgcagaggacatgaagggcaggata
tttgtattcgccactaagatggccatggtaaagcaggtgccttcggaggaatttgagacc
aacaaccgggtggtggcagccaccaagctccaggagggggatgaactggcggccgtgata
ccggtggagggcgagaccgaggtggtgatccagacaacaggaggcgtgttcctgcggttt
gccctggaggagatatccatgcttaaaaaggcatccagaggtgtcagaggcatccggctg
accaagaatgaggagctggagaagctgtatctgattggtgagaatcccattgtggattac
aagggtaaggaagtccatttaaaccgtctgaaactggccaagagggacgggaaaggcagc
aaagtgcggctgtag

DBGET integrated database retrieval system