KEGG   Clostridium bolteae: CGC65_29015Help
Entry
CGC65_29015       CDS       T05466                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
cbol  Clostridium bolteae
Pathway
cbol00040  Pentose and glucuronate interconversions
cbol00051  Fructose and mannose metabolism
cbol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGC65_29015
   00051 Fructose and mannose metabolism
    CGC65_29015
Enzymes [BR:cbol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CGC65_29015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ASN98370
LinkDB All DBs
Position
complement(6255393..6256313)
Genome map
AA seq 306 aa AA seqDB search
MKYATRINSFLRFDSNLLNAFRSIGSIEGVDYVDLNYPEHFADYDIEVIKAKMEECGLRC
NAINLRFRDKYIGGEFGNHEPAISQDAITLCREAADACRKLGGNQMIIWLGFDGFDYSFQ
IDYVSYWNRIVKAFRDVCDYSKVPVSIEYKPYEERVHAFIDSFGTAVSILHDVDRENLGV
TLDFCHMLMKKENPAFAAAWLLERGKLYNIHLNDGEGSTDDGLMVGTVNFWKTVEVMYYL
KKYDFQGVIYFDTFPKREKAVEECEANIKMCRRIEQLIDAYGLCRMEKVVEQNDAVAVSS
MMVALL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgccacacggattaactcgtttttgagatttgacagcaacctgctgaatgca
ttccgttccataggctccattgaaggagtggattatgtggatttgaattatccggaacat
tttgctgattatgatatagaggtgataaaggcaaagatggaggaatgcggactgagatgt
aatgccattaatctcaggttcagggacaagtacataggaggagagttcggaaaccatgag
ccggccatatcgcaggacgccataactttatgcagggaggcggcagatgcgtgcagaaag
ctgggaggaaaccagatgattatatggctgggatttgacggttttgattattccttccag
attgattatgtaagctactggaaccggattgtgaaggcgttccgggatgtgtgcgactat
tccaaggtgcctgtgagcattgagtacaaaccctatgaggagagggtccacgcttttatt
gacagctttggaactgcggtttccattctccacgatgtggacagggaaaacctgggggtg
accctggacttctgccacatgctgatgaagaaggagaatcccgcgtttgcagcggcctgg
ctgctggagcgggggaaactctacaatatacatctcaatgacggagagggttccacggat
gacggcctgatggtgggaaccgtgaatttctggaagacagtggaggtcatgtactacctt
aaaaaatatgacttccagggtgtgatatattttgacacatttccaaagcgggagaaggcg
gtggaagaatgtgaggcaaatataaagatgtgccggcggattgaacagcttattgacgcc
tatggactctgccggatggagaaggtggtggaacagaacgatgcggtagctgtaagcagc
atgatggttgctttattataa

DBGET integrated database retrieval system