KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_02195Help
Entry
ATE48_02195       CDS       T04422                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATE48_02195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbot02000]
    ATE48_02195
Enzymes [BR:cbot01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ATE48_02195
Transporters [BR:cbot02000]
 Other Transporters
  Pores ion channels [TC:1]
   ATE48_02195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ANP44818
UniProt: A0A1B1AE30
LinkDB All DBs
Position
417460..418098
Genome map
AA seq 212 aa AA seqDB search
MADKLTFYTNPMSRGRIIRWMLEEVGQPYETVILGYGASMKGPEYLAINPMGKVPAIKHG
NAVVTEGAAICAYLADVFPQANLAPANNDERARYYRWMFFAAGPIEAAANAKAMGWEAPA
DKQGMLGFGSMAHVLDALEFALKDTPYIAGDRFTAADVYFGSHIMWGTQFGTLEKRTVFE
PYMARLHNRPAAVRARDIDDAIIAEQQKQQQQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagctcacattttatacgaacccaatgtcgcgcgggcggatcatccgatgg
atgctggaagaagtcggccaaccctatgaaacagtcattctcggctatggcgcgagcatg
aaggggccggaatatttggcgatcaatcccatgggcaaggtgcccgcgatcaagcacgga
aacgccgtcgtaacggaaggcgccgccatctgcgcctatctcgccgacgtcttcccccaa
gcgaacctcgccccggcaaacaacgacgaacgcgcacgctattatcgctggatgttcttc
gccgcagggccaatcgaagcggccgcgaacgccaaagcgatgggatgggaagcccctgcc
gacaaacaaggcatgctcggcttcggatcgatggcgcacgtgctggatgcgctggagttc
gcacttaaggacacgccctacattgcgggcgatcggttcacggcagcggacgtctatttc
gggtcgcacatcatgtggggcactcaattcggcacgctggaaaagcgcacagtgttcgag
ccctacatggcgcggcttcacaatcgcccggcagcggtccgcgcgcgcgacatcgacgac
gccatcatcgccgaacaacaaaagcaacaacaacaatag

DBGET integrated database retrieval system