KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_11485Help
Entry
ATE48_11485       CDS       T04422                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00010  Glycolysis / Gluconeogenesis
cbot00620  Pyruvate metabolism
cbot01100  Metabolic pathways
cbot01110  Biosynthesis of secondary metabolites
cbot01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATE48_11485
   00620 Pyruvate metabolism
    ATE48_11485
Enzymes [BR:cbot01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ATE48_11485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ANP46494
UniProt: A0A1B1AIV5
LinkDB All DBs
Position
complement(2228540..2230051)
Genome map
AA seq 503 aa AA seqDB search
MTIANPDPRSPFKSRYDNFIGGKWTPPKSGRYFTNSSPVNGKPICEIARSDAADIEAALD
AAHAAKAAWGRTPVGERAQILNRIADRMEQNLELLATCETWDNGKPIRETMAADLPLAVD
HFRYFAACVRSQEGSLGEIDNDTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGN
CVVLKPAEQTPATIMVFAELVGDLLPTGVLNIVNGFGLEAGKPLASSPRIAKIAFTGETT
TGRLIMQYASENLIPVTLELGGKSPNIFFEDVATADDDFFDKALEGFTMFALNQGEVCTC
PSRALVHEKIYDRFMERALKRVEAIVQGDPRNPATMIGAQASSEQKEKILAYFDIGRQEG
ARVLTGGEAAHLGGELEGGYYIRPTVLRGHNKMRVFQEEIFGPVVSVTTFKDADEALAIA
NDTLYGLGAGVWSRDANTCYRFGRGIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKM
MLNHYQQTKNMLVSYSPKKLGFF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgcaaaccccgatccgcgctctccgttcaaaagccggtacgacaactttatc
ggcggcaagtggacgccgccgaaatccgggcgctacttcaccaattcatcgccggtgaac
ggcaaaccgatctgcgagattgcccgctccgatgcagccgacatcgaagccgcacttgat
gcagcgcatgcggcgaaagccgcctggggccgcacgccggtcggcgaacgcgcgcaaatt
ctcaacagaattgccgatcgcatggagcaaaatctcgaactgctcgcgacctgcgaaacc
tgggacaacggcaaaccgatccgcgaaactatggccgccgacctgccgctcgcggtcgat
cacttccggtacttcgccgcctgcgtgcgttcacaagaaggctcgcttggcgaaatcgac
aacgacaccgtcgcctatcacttccatgaaccgctcggcgtcgtcggccaaatcatcccg
tggaacttcccgctgttgatggccgcctggaagctcgcgccggcgctcgccgccggcaat
tgcgtagtgctgaagcccgctgaacagacgccggccaccatcatggtgttcgccgagctc
gtgggcgatcttctgccgacgggcgtgctcaacatcgtcaacggatttggtcttgaagcc
ggcaagccgctcgcatccagcccgcgcattgccaagatcgccttcaccggcgaaacgacg
actggccgcctgatcatgcagtatgcgtcggaaaacctcattccggtgacgctcgaactc
ggcggcaaatcgccgaacatcttcttcgaggacgtcgccaccgccgatgacgacttcttc
gacaaggccctcgagggcttcaccatgttcgcgctcaatcagggtgaagtttgcacctgc
ccgtcacgcgcccttgtgcatgagaagatctacgatcgcttcatggaacgcgcgctgaag
cgcgtcgaggccatcgtccaaggtgacccgcgcaaccccgccaccatgatcggcgcgcag
gcgtcgtctgagcaaaaggaaaagatcctcgcctatttcgacatcggccgccaagaaggc
gcaagagtgctgaccggcggcgaagcagcgcatctcggcggcgaacttgaaggcggctac
tacatccgcccgacggtcctgcgcggtcacaacaagatgcgcgtcttccaagaggaaatc
ttcggacccgtcgtgtcggttaccacgttcaaggacgcggacgaagcactcgcgatcgcc
aacgacacgctctacggcctcggagccggcgtgtggagccgcgatgcgaacacctgctat
cgcttcggtcgcggcatcaaagccggccgtgtctggacaaattgctatcacgcctacccc
gcacacgcggcgttcggcggctacaagcaatccggcatcgggcgcgaaacccacaagatg
atgctcaatcactaccagcaaaccaagaacatgctggtgagctacagtcccaagaagctc
ggcttcttctaa

DBGET integrated database retrieval system