KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_11890Help
Entry
ATE48_11890       CDS       T04422                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ATE48_11890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbot03400]
    ATE48_11890
Enzymes [BR:cbot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ATE48_11890
DNA repair and recombination proteins [BR:cbot03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ATE48_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANP46568
UniProt: A0A1B1AJ26
LinkDB All DBs
Position
complement(2309759..2312239)
Genome map
AA seq 826 aa AA seqDB search
MKRPAKAGGGKKTAKSDAVGGLAEYNRKRDFKKTTEPAGGVVKDAGGMFVVQKHAATRLH
YDFRLEHDGVLMSWAVPQGPSLDPAIKRLAMRTENHPIEYGSFEGVIPKGEYGAGAVIIW
DTGKVKWLLDPDEGMAKGELKFVLAGDRLMGEFHMVKIKPREGERGNPWLLFKSKDAFAG
KEDPVARSVTSVVSGRTIEDVRSGGARVWSKGGERAPKAVKPPKWAFVEPALATRVDDAP
KGDAWIHEIKYDGYRIQAAVSGDSVRLYTRTGLDWTGKFQSIADALAASKLKDILIDGEV
AVAQAGGKTDFSALQKSLENGVAKGVSYFVFDLLAEGAKDLRKTPLIDRKLRLERILAKA
KPPIRISPYFEGGGPDVLEAFRDQGLEGIVSKKATSTYQSGRTNSWLKAKCVNEQEFVII
GYQPSLKGRAFAALMMADHVDGELVYRGNVGTGFDDKTLASLHAQLSKMERAKPALTVPR
AAAKGAKWVEPKLVAQVRFAEFTSEGAIRHGVYLGLRGDKAAKDVQPEQAVPAMRTRVRL
THPGKVLFPDAGVTKAELAAYLDMAADRMGAHLFGRPVSLVRAPDGVGGQTFFQKHAMKG
MPAEIKLIKVSESDGEAEEYITFPDATAIVSAAQISTLEFHLWGSRNKDLERPDRLIFDL
DPDEDLDFQVVKRAAFDIRALLDSADLQSFAMITGGKGIHIVLNVKPKLAWEELKAFSSD
VAEQIAALDPKRFVANMAKAKRKGRIFVDYLRNGRGATAIAPYSPRASGTAPIAVPVSWD
ELKTIPAASVFKLKDMHARLSQPDPWADYAKSAVSITATTRRKLGL
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcccgccaaagctggcggcgggaagaaaacggccaagtcggacgcggtcggc
ggtctggccgaatacaaccgcaagcgcgatttcaaaaagacgactgaacccgccggcggc
gtcgtaaaggacgcgggcggcatgttcgttgtgcaaaagcatgcggcgacacggctgcac
tacgacttccgacttgagcatgatggcgtgctgatgagctgggctgtgccgcaaggcccc
tcgctcgaccccgccatcaagcgcctcgccatgcgcaccgaaaatcaccccatcgaatac
ggatcgttcgagggcgtcattccgaagggtgaatatggcgcgggcgcggtgatcatctgg
gacaccggcaaagtaaaatggctgctcgatccagatgaaggcatggcgaagggtgaattg
aaattcgtgttggccggcgatcggctgatgggtgaatttcacatggtcaaaatcaagccg
cgcgagggtgagcgcggcaatccgtggctattgttcaaatcgaaggacgccttcgccggc
aaggaagatccggttgcgcgcagcgtcaccagcgttgtctccggccgcacgatcgaagac
gtgcgatcaggcggcgcgcgcgtgtggagcaaaggcggcgagcgagcgccgaaagcggta
aagccgccaaaatgggcgtttgtggaaccggccttggcgacacgcgtggacgacgcaccc
aagggcgatgcctggattcacgagatcaagtatgacggttatcgcatccaggcagccgtg
agcggcgacagcgtgcggctttacacgcgcacgggactggattggaccggcaaatttcag
tccatcgccgatgcactcgcggcgtcaaagctgaaagacatcctgatcgatggtgaagtc
gccgttgcgcaagccggcggcaagacggacttctccgcactgcaaaaatcactcgaaaac
ggcgtcgccaaaggcgtttcgtatttcgtgttcgatctcttggcggaaggcgcaaaagat
ctccgcaagacgccactgatcgatcgcaaactgaggctggaaagaatccttgccaaggca
aaaccgccgatacgcatcagcccttatttcgaaggcggtggcccagacgtcctggaggcg
tttcgcgatcaaggactggaaggaattgtttcgaaaaaggcgacgtccacttatcaaagc
ggacgcaccaattcttggctcaaggcaaaatgcgtcaacgagcaggaattcgtcattatc
ggttatcagccctccctcaagggacgcgccttcgcagcgctgatgatggccgatcatgtg
gacggcgagctggtctatcgcggcaatgttggcactggcttcgacgataagacactcgcc
tccctccacgcgcagctgagcaagatggagcgcgcgaaaccagcgctgactgtgccgcgc
gcggcagcgaaaggcgcgaagtgggttgagccaaagctcgtggcgcaagtgcggttcgcg
gaatttacaagtgaaggcgcaatccgccacggcgtttacctcggactgcgcggcgacaag
gccgcgaaggatgtgcagcccgaacaggcagttccggcgatgcgcacgcgcgtcaggctc
acgcatccagggaaggtattgtttcccgacgccggcgtcaccaaggccgaactcgccgcc
tatctcgacatggccgcagatcggatgggcgcgcacttgttcgggcgaccagtcagtctc
gtgcgcgcgccggatggcgttggcggacagacattcttccagaagcacgcaatgaagggc
atgcccgcggaaatcaaacttatcaaagtgtctgaaagtgacggcgaggccgaagaatac
attacatttccggacgccaccgcgatcgtttctgctgctcagatcagcacgcttgagttt
catctctggggctcacgcaacaaagatctggagcgccccgaccgcctcatcttcgatctc
gatcctgacgaagacctcgactttcaagtggtaaaacgcgccgcgttcgacatcagagct
ctgctcgacagcgccgacctccagtcgttcgcgatgatcaccggcggcaagggcattcac
atcgtgctcaatgtgaagcccaaactggcgtgggaggaattgaaagccttctcctccgat
gtcgctgaacaaatcgccgcgctcgatcccaagcgcttcgtcgccaacatggcgaaggcg
aagcgcaaaggccgcatcttcgtcgactatttgcgcaacgggcgcggcgcgacggctatc
gctccatattcgccgcgcgcgagcggaacagcgccaatcgccgtgcccgtgagctgggat
gagctgaagacgattcctgcagcgtcggttttcaaactgaaagacatgcacgcgcgtctg
agccagccagatccatgggcagattacgccaagagcgccgtcagcatcacggccacgaca
cggcgaaaattggggctctga

DBGET integrated database retrieval system