KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_15480Help
Entry
ATE48_15480       CDS       T04422                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
cbot00473  D-Alanine metabolism
cbot00550  Peptidoglycan biosynthesis
cbot01100  Metabolic pathways
cbot01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATE48_15480
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATE48_15480
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ATE48_15480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbot01011]
    ATE48_15480
Enzymes [BR:cbot01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ATE48_15480
Peptidoglycan biosynthesis and degradation proteins [BR:cbot01011]
 Precursor biosynthesis
  Amino acid ligase
   ATE48_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 GARS_A ATPgrasp_Ter CPSase_L_D2 RimK ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ANP47220
UniProt: A0A1B1AL21
LinkDB All DBs
Position
3024233..3025153
Genome map
AA seq 306 aa AA seqDB search
MARVAVLLGGLSPERPVSLSSGKGCADALRRLGHDVIEIDPQNPNWISELADAAPDAVFN
ALHGEWGEDGRTQGVLDYLKLPYTHSGVLASALAMDKDKSKAVFAQAGLPLANGKLMHRL
EAAKGHPMPAPYVVKPNAQGSSVGIFIVREGANRPPEQLLDPDWTFGEEVLVEEFIDGKE
LTVAVMHDRGALAVTEIFVTSDGDWYDFDAKYSSGGSRHVVPANIPQSVADQCMRAAEAA
HHALGCRGVSRSDFRYDPKTDRLALLEVNTQPGMTPTSLTPEQAAHVGLSYDQLVQWILE
DASWPR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcccgagtggcggtgctactagggggattaagccccgagaggccagtgagcctcagt
tccggcaagggctgcgctgacgcgctgcgccggcttggtcacgacgtgatcgagatcgac
cctcaaaatccgaattggatctccgagttggccgacgccgcgccggacgcggtgttcaac
gccctccacggtgagtggggtgaggacggccgcacccaaggcgtgctcgactatctgaag
cttccttacacgcattcgggcgtgctcgcgtcggcgctggcgatggacaaggataagtcc
aaggcggtgtttgcgcaggccgggctgccgctcgccaatggtaagctgatgcatcgcctg
gaggccgcgaagggccacccgatgcccgcgccttatgttgtgaagccgaacgcgcagggc
tcgtcggtcggcatctttatcgtgcgtgagggcgctaatcgtccgcccgaacaattgctc
gatcctgattggacctttggcgaggaggtgctcgtcgaggaattcatcgacggcaaagag
ctcaccgttgcggtcatgcatgatcgcggcgcgttggcggtcactgaaatcttcgtcacc
agcgatggtgattggtacgattttgacgccaagtattcgagcggtggttcaaggcacgtg
gtgcctgccaacattccacaatcggtcgcggatcagtgcatgcgcgccgctgaagccgcg
caccatgcgcttggctgtcgcggcgtctcgcgcagcgacttccgctacgatccgaagacc
gatcgtttggcgctgcttgaagtgaacacccagcccggcatgacgccgacgtcgttgacg
ccggaacaagccgctcacgttggtctctcttacgaccagctcgtccagtggatactggag
gatgcatcatggccgcggtga

DBGET integrated database retrieval system